NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS50395.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50395.1 Public Mus musculus 19 Ms4a6c 23 108 98 CCDS HistoryNCBI Gene:73656Re-query CCDS DB by CCDS ID:50395.1Re-query CCDS DB by GeneID:73656See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 50395.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000165310.2 ENSMUSP00000132425.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000165310.2Link to Ensembl Protein Viewer:ENSMUSP00000132425.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000165310Re-query CCDS DB by Protein ID:ENSMUSP00000132425
Original member Current member NCBI NM_028595.4 NP_082871.2 Accepted alive Link to Nucleotide Sequence:NM_028595.4Link to Protein Sequence:NP_082871.2Re-query CCDS DB by Nucleotide ID:NM_028595Re-query CCDS DB by Protein ID:NP_082871Link to BLAST:NP_082871.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_082871.2 217 Q99N08-1 217 100% 0 0

Chromosomal Locations for CCDS 50395.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 11471105 11471251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11472393 11472527 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11475274 11475330 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11478168 11478374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11480299 11480399 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11481206 11481212 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (654 nt):
ATGATTCCACAGGTAGTGACCAATGAGACCATCACAACGATTTCACCAAATGGAATCAACTTTCCCCAAA
AA
GACGAGTCCCAGCCTACCCAACAGAGGCAAGACAGCCTGAAGAAACATCTAAAGGCTGAGATCAAAGT
G
ATAGTGGCAATCCAGATCATGTGTGCTGTGACAGTGTTGGCTCTGGGAATCATTTTGGCATCTGTTCCT
CCT
GTCCCATATTTTAACTCAGTGTTTTCTGTCCTGTTAAAATCTGGCTACCCATTTATAGGAGCTTTGT
TT
TTTATTGCCTCTGGAATTTTGTCCATCATTACGGAGAGAAAGTCAACAAAACCTTTGGTAGATGCCAG
C
CTAACTCTGAATATCCTGAGTGTTTCATTTGCTTTCGTGGGCATCATTATCATCTCTGTCAGCCTGGCT
GGT
TTGCATCCTGCCTCAGAGCAATGCAAGCAGAGCAAGGAGCTTAGTCTAATTGAACATGACTACTACC
AA
CCTTTCTACAACTCAGACAGGAGTGAATGTGCCGTCACCAAGTCTATTCTGACTGGAGCCCTTTCAGT
G
ATGCTGATCATCAGTGTGTTGGAGCTTGGTCTGGCTTTGCTCTCTGCCATGCTGTGGTTGAGAGAGGGT
GTT
CTGACTTCCCTTAGAATGTGA


Translation (217 aa):
MIPQVVTNETITTISPNGINFPQKDESQPTQQRQDSLKKHLKAEIKVIVAIQIMCAVTVLALGIILASVP
P
VPYFNSVFSVLLKSGYPFIGALF
FIASGILSIITERKSTKPLVDASLTLNILSVSFAFVGIIIISVSLA
G
LHPASEQCKQSKELSLIEHDYYQPFYNSDRSECAVTKSILT
GALSVMLIISVLELGLALLSAMLWLREG
V
LTSL
RM



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser