NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS50411.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50411.1 Public Mus musculus 19 Vldlr 23 108 98 CCDS HistoryNCBI Gene:22359Re-query CCDS DB by CCDS ID:50411.1Re-query CCDS DB by GeneID:22359See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 50411.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000172302.7 ENSMUSP00000126730.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000172302.7Link to Ensembl Protein Viewer:ENSMUSP00000126730.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000172302Re-query CCDS DB by Protein ID:ENSMUSP00000126730
Original member Current member NCBI NM_001161420.1 NP_001154892.1 Accepted alive Link to Nucleotide Sequence:NM_001161420.1Link to Protein Sequence:NP_001154892.1Re-query CCDS DB by Nucleotide ID:NM_001161420Re-query CCDS DB by Protein ID:NP_001154892Link to BLAST:NP_001154892.1

Chromosomal Locations for CCDS 50411.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 27217615 27217696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27230196 27230315 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27234790 27234912 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27236240 27236362 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27238053 27238424 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27238510 27238632 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27238724 27238846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27239622 27239741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27239845 27239970 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27240466 27240637 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27241235 27241453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27243065 27243183 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27243758 27243897 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27244199 27244340 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27245535 27245681 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27247010 27247090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27247857 27248026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 27249105 27249140 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2538 nt):
ATGGGCACGTCCGCGCGCTGGGCGCTGTGGCTGCTGCTCGCGCTGTGCTGGGCGCCCCGGGACAGCGGCG
CC
ACTGCAAGCGGGAAGAAAGCCAAATGTGATAGCTCCCAGTTTCAGTGCACAAATGGCCGCTGCATTAC
C
CTGCTGTGGAAATGTGATGGAGATGAAGACTGTGCGGATGGCAGCGACGAGAAGAACTGTGTAAAGAAG
ACG
TGTGCTGAGTCTGACTTCGTGTGCAAAAACGGCCAGTGTGTTCCTAACAGATGGCAGTGTGACGGGG
AT
CCTGATTGCGAAGACGGTTCTGATGAAAGCCCTGAACAGTGCCATATGAGAACATGCCGCATAAATGA
A
ATCAGCTGTGGCGCCCGTTCTACTCAGTGTATCCCCGTGTCCTGGAGATGCGATGGTGAAAATGATTGT
GAC
AATGGAGAAGATGAAGAAAACTGTGGCAACATAACATGTAGTGCAGATGAGTTCACTTGCTCCAGTG
GC
CGCTGCGTCTCCAGAAACTTTGTGTGCAATGGCCAGGATGACTGTGACGATGGCAGTGATGAGCTGGA
C
TGTGCTCCACCAACCTGCGGAGCCCACGAGTTCCAGTGCAGCACCTCTTCCTGCATTCCCCTCAGCTGG
GTG
TGTGATGATGACGCAGACTGTTCAGACCAATCAGACGAGTCTCTTGAGCAGTGTGGCCGTCAGCCTG
TG
ATACATACCAAATGTCCTACCAGTGAGATCCAGTGTGGCTCTGGCGAGTGCATTCACAAAAAATGGCG
G
TGTGACGGAGACCCTGACTGCAAGGACGGCAGCGATGAGGTCAACTGCCCTTCTCGAACCTGCCGACCT
GAC
CAGTTTGAATGTGAAGATGGTAGCTGTATCCACGGCAGCAGGCAATGCAATGGCATCCGAGACTGTG
TT
GATGGCTCTGATGAAGTCAACTGCAAAAACGTCAATCAGTGCCTGGGCCCTGGAAAGTTCAAGTGCAG
A
AGCGGGGAATGCATAGACATGAGCAAAGTATGTGACCAGGAACAAGACTGCAGAGACTGGAGTGACGAG
CCC
CTGAAGGAATGCCATATCAACGAATGCCTGGTCAATAATGGTGGCTGTTCCCATATCTGCAAAGACC
TA
GTTATAGGTTATGAGTGTGATTGTGCAGCTGGGTTTGAACTGATAGATAGGAAAACCTGTGGAGATAT
T
GATGAATGCCAAAACCCGGGGATCTGCAGTCAAATTTGTATCAACTTAAAAGGCGGTTACAAGTGTGAA
TGT
AGTCGTGGCTATCAAATGGATCTTGCCACTGGCGTGTGCAAGGCAGTAGGCAAAGAGCCGAGTCTGA
TC
TTCACTAATCGAAGAGACATCAGGAAGATTGGCCTAGAGAGAAAGGAATACATCCAACTTGTAGAGCA
A
CTAAGGAACACGGTGGCTCTCGATGCGGACATTGCAGCTCAGAAGCTGTTTTGGGCTGATCTCAGCCAG
AAG
GCCATCTTCAGTGCCTCAATTGATGACAAGGTTGGTAGACATTTTAAAATGATCGACAATGTCTATA
AT
CCTGCAGCCATTGCTGTTGATTGGGTGTACAAGACCATCTACTGGACTGATGCGGCTTCTAAGACTAT
T
TCAGTAGCTACCCTAGACGGAGCCAAGAGGAAGTTCCTGTTTAATTCTGACTTGCGAGAGCCTGCCTCC
ATA
GCTGTGGATCCGTTGTCGGGCTTTGTTTACTGGTCAGACTGGGGCGAGCCAGCTAAAATAGAAAAAG
CA
GGAATGAATGGATTTGATAGACGTCCTCTGGTGACGGAGGACATCCAATGGCCTAATGGAATTACACT
C
GACCTTGTCAAAAGCCGCCTCTACTGGCTGGATTCCAAGTTGCACATGCTCTCTAGTGTGGACCTGAAT
GGT
CAAGATCGTAGGATAGTGCTCAAGTCTCTGGAGTTCCTAGCTCATCCTCTTGCACTCACCATATTTG
AG
GATCGCGTCTACTGGATAGATGGAGAAAATGAAGCAGTGTACGGTGCCAATAAATTCACTGGGTCAGA
G
CTGGCCACTCTAGTGAATAATCTCAATGATGCCCAAGACATCATTGTCTACCATGAACTCGTCCAGCCG
TCA
GGTAAAAACTGGTGTGAAGACGATATGGAGAATGGAGGATGTGAATATCTCTGCCTGCCAGCACCAC
AG
ATCAATGACCACTCTCCAAAATATACCTGTTCCTGTCCCAATGGGTACAATCTCGAAGAAAATGGACG
A
GAGTGTCAAAGGATCAATGTGACCACAGCAGTATCAGAAGTCAGTGTTCCCCCAAAAGGGACTTCAGCT
GCC
TGGGCCATCCTTCCTCTCTTGCTCTTAGTGATGGCAGCAGTAGGTGGCTACTTGATGTGGAGGAATT
GG
CAACATAAAAACATGAAAAGCATGAACTTTGACAATCCTGTGTACTTGAAGACCACTGAAGAGGACCT
G
TCGATAGACATTGGTAGACACAGCGCTTCTGTAGGACACACATACCCAGCAATATCAGTTGTAAGCACA
GAT
GATGATCTGGCTTGA


Translation (845 aa):
MGTSARWALWLLLALCWAPRDSGATASGKKAKCDSSQFQCTNGRCITLLWKCDGDEDCADGSDEKNCVKK
T
CAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQC
HMRTCRINEISCGARSTQCIPVSWRCDGENDC
D
NGEDEENC
GNITCSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDCAPPTCGAHEFQCSTSSCIPLSW
V
CDDDADCSDQSDESLEQCGRQPVIHTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNC
PSRTCRP
D
QFECEDGSCIHGSRQCNGIRDCVDGSDEVNCKN
VNQCLGPGKFKCRSGECIDMSKVCDQEQDCRDWSDE
P
LKEC
HINECLVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCE
C
SRGYQMDLATGVCKAV
GKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQ
K
AIF
SASIDDKVGRHFKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGAKRKFLFNSDLREPAS
I
AVDPLS
GFVYWSDWGEPAKIEKAGMNGFDRRPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLN
G
QDRRIVLKSLEFLAHPLALTIFE
DRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQP
S
GKNWCEDDMENGGCEYLCLPAPQINDHSPKYTCSCPNGYNLEENGRECQRINVTTAVSEVSVPPKGTSA
A
WAILPL
LLLVMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKTTEEDLSIDIGRHSASVGHTYPAISVVST
D
DDLA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser