NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS50679.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50679.1 Public Mus musculus 2 Capn3 23 108 98 CCDS HistoryNCBI Gene:12335Re-query CCDS DB by CCDS ID:50679.1Re-query CCDS DB by GeneID:12335See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 50679.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000110721.7 ENSMUSP00000106349.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110721.7Link to Ensembl Protein Viewer:ENSMUSP00000106349.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000110721Re-query CCDS DB by Protein ID:ENSMUSP00000106349
Original member Current member NCBI NM_001177799.1 NP_001171270.1 Accepted alive Link to Nucleotide Sequence:NM_001177799.1Link to Protein Sequence:NP_001171270.1Re-query CCDS DB by Nucleotide ID:NM_001177799Re-query CCDS DB by Protein ID:NP_001171270Link to BLAST:NP_001171270.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001171270.1 729 Q64691-2 729 100% 0 0

Chromosomal Locations for CCDS 50679.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 120463873 120464181 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120480683 120480752 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120482110 120482228 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120484491 120484624 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120485181 120485349 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120488074 120488157 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120489668 120489753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120490954 120491031 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120491794 120491954 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120494772 120494941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120495236 120495247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120495865 120496073 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120496978 120497014 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120502103 120502180 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120502387 120502444 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120502529 120502593 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120502976 120503044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120503133 120503211 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120503349 120503465 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120504096 120504154 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 120504473 120504499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2190 nt):
ATGCCAACTGTTATTAGTCCAACTGTGGCCCCAAGGACGGGGGCTGAGCCCAGGTCCCCAGGGCCAGTTC
CT
CACCCAGCTCAAGGCAAGACCACCGAGGCTGGAGGTGGACACCCAAGTGGCATCTATTCGGCCATCAT
T
AGCCGCAATTTTCCGATCATCGGTGTGAAAGAGAAGACATTTGAGCAGCTCCGCAGGAAGTGCCTAGAG
AAG
AAAGTTCTTTATCTAGACCCCGAGTTCCCACCGGATGAGACCTCTCTCTTTTACAGTCAGAAGTTCC
CC
ATCCAGTTCGTCTGGAAGAGACCTCCGGAAATTTGTGAGAATCCCCGGTTTATCATTGGTGGAGCCAA
C
AGGACTGACATCTGCCAAGGAGATCTAGGGGACTGCTGGTTTCTTGCAGCCATCGCCTGCCTGACCCTG
AAT
GAGCGGCTGCTTTTCCGAGTTATACCCCATGATCAAAGTTTCACTGAAAACTACGCAGGGATCTTCC
AC
TTCCAGTTCTGGCGCTATGGAGACTGGGTAGATGTGGTCATTGACGACTGTCTGCCAACATACAACAA
T
CAGCTGGTTTTCACCAAATCCAACCACCGCAATGAGTTCTGGAGTGCTCTCCTTGAGAAGGCTTATGCC
AA
G
CTCCATGGCTCCTATGAAGCTCTGAAAGGTGGGAATACCACAGAAGCCATGGAGGACTTCACAGGAG
GG
GTGACAGAGTTTTTTGAGATCAAGGATGCTCCGAGTGACATGTACAAGATTATGAGGAAAGCTATCGA
G
AGAGGCTCCCTCATGGGCTGCTCCATTGACACAATTGTTCCAGTGCAGTATGAAACAAGAATGGCCTGT
GGG
TTGGTGAAAGGGCATGCCTATTCAGTCACTGGGCTGGAGGAGGCCCTGTTCAAAGGTGAGAAGGTGA
AG
TTGGTGCGGCTGCGGAACCCCTGGGGCCAGGTGGAGTGGAACGGCTCTTGGAGTGATGGTTGGAAGGA
C
TGGAGCTTTGTAGACAAAGATGAGAAGGCCCGTCTACAGCACCAGGTTACTGAGGATGGAGAGTTCTGG
ATG
TCATATGATGACTTCGTCTACCATTTCACGAAGCTGGAGATCTGCAACCTCACAGCTGACGCCCTGG
AG
TCCGATAAGCTTCAGACCTGGACGGTGTCTGTAAACGAGGGCCGCTGGGTGAGGGGCTGTTCTGCTGG
A
GGCTGCCGAAACTTCCCAGACACTTTCTGGACCAACCCGCAGTACCGTCTCAAGCTTCTGGAGGAAGAC
GAT
GACCCTGAGGACTCTGAGGTAATCTGCAGCTTCCTCGTGGCTCTGATGCAGAAGAACCGGCGCAAGG
AC
CGGAAGCTGGGGGCCAACCTCTTCACTATTGGCTTCGCCATCTACGAGGTTCCCAAAGAGATGCACGG
G
AATAAGCAACACCTGCAGAAGGACTTCTTCTTGTACAACGCCTCCAAGGCCAGAAGCAAAACCTACATC
AAC
ATGCGGGAGGTGTCCCAGCGCTTCCGCCTGCCACCCAGCGAGTATGTCATCGTACCCTCCACCTACG
AG
CCCCACCAGGAGGGGGAATTCATCCTCCGAGTCTTCTCCGAAAAGAGGAATCTCTCTGAGGAAGCTGA
A
AATACAATCTCTGTGGATCGGCCAGTGCCAAGGCCTGGCCACACAGACCAGGAAAGTGAGGAGCAGCAG
CAA
TTCCGGAACATCTTCAGGCAGATCGCAGGCGACGACATGGAGATCTGTGCAGATGAACTCAAGAATG
TC
CTCAACACAGTGGTGAACAAACACAAGGACCTGAAGACACAAGGGTTCACGCTGGAGTCCTGCAGAAG
C
ATGATAGCTCTCATGGATACAGATGGCTCTGGAAGACTGAATCTTCAAGAGTTCCATCACCTCTGGAAA
AAG
ATCAAGGCCTGGCAGAAAATCTTCAAGCACTATGACACAGACCATTCCGGTACCATCAATAGCTATG
AG
ATGCGAAATGCAGTCAATGATGCAGGCTTCCATCTCAACAGCCAACTCTATGACATCATCACCATGCG
C
TATGCGGACAAACACATGAACATCGACTTTGACAGCTTCATCTGCTGCTTCGTCAGGCTGGAAGGGATG
TTC
AGAGCTTTTAACGCATTTGACAAGGATGGCGATGGTATCATCAAACTGAATGTACTTGAGTGGCTGC
AG
CTTACCATGTATGCCTGA


Translation (729 aa):
MPTVISPTVAPRTGAEPRSPGPVPHPAQGKTTEAGGGHPSGIYSAIISRNFPIIGVKEKTFEQLRRKCLE
K
KVLYLDPEFPPDETSLFYSQKFPIQFVWKRPP
EICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTL
N
ERLLFRVIPHDQSFTENYAGIFHFQ
FWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYA
K
LHGSYEALKGGNTTEAMEDFTGGVTEFFEIKDAPSDMYKIMRKAIERGSLMGCSIDTIVPVQYETRMAC
G
LVKGHAYSVTGLEE
ALFKGEKVKLVRLRNPWGQVEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFW
M
SYDDFVYHFTKLEICNLTADALESDKLQTWTVSVNEGRWVRGCSAGGCRNFP
DTFWTNPQYRLKLLEED
D
DPEDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYE
VPKEMHGNKQHLQKDFFLYNASKARSKTYI
N
MREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLS
EEAENTISVDRPVPRPGHTDQESEEQQ
Q
FRNIFRQIAGD
DMEICADELKNVLNTVVNKHKDLKTQGFTLESCRSMIALMDTDGSGRLNLQEFHHLWK
K
IKAWQ
KIFKHYDTDHSGTINSYEMRNAVNDAGFHLNSQLYDIITMRYADKHMNIDFDSFICCFVRLEGM
F
RAFNAFDKDGDGIIKLNVLEWLQLTMYA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser