NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS51506.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51506.1 Public Mus musculus 5 Arap2 23 108 98 CCDS HistoryNCBI Gene:212285Re-query CCDS DB by CCDS ID:51506.1Re-query CCDS DB by GeneID:212285See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 51506.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000076623.7 ENSMUSP00000075924.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000076623.7Link to Ensembl Protein Viewer:ENSMUSP00000075924.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000076623Re-query CCDS DB by Protein ID:ENSMUSP00000075924
Original member Current member NCBI NM_178407.3 NP_848494.2 Accepted alive Link to Nucleotide Sequence:NM_178407.3Link to Protein Sequence:NP_848494.2Re-query CCDS DB by Nucleotide ID:NM_178407Re-query CCDS DB by Protein ID:NP_848494Link to BLAST:NP_848494.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_848494.2 1703 Q8BZ05-1 1703 99.8238% 0 3

Chromosomal Locations for CCDS 51506.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 62604270 62604656 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62606075 62606209 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62611704 62611767 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62613994 62614029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62615004 62615086 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62621839 62621966 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62630133 62630261 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62635952 62636069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62638962 62639036 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62641328 62641396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62642795 62642942 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62646183 62646288 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62649689 62649901 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62654046 62654209 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62668789 62668852 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62669027 62669225 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62669880 62669982 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62670936 62671080 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62675952 62676086 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62676512 62676686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62677102 62677284 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62677945 62678030 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62683355 62683554 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62685561 62685676 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62698241 62698419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62706608 62706728 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62714733 62714802 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62730521 62730874 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62732970 62733061 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62733900 62733976 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62734988 62735046 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 62748776 62749674 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5112 nt):
ATGTCCTCAGTCAGCGAAGTAAATGCGGACATCAGAGATTTCCTGATGAGCATCAATTTGGAGCAGTACC
TC
TTACATTTCCGTGAATTCGGTTTTTATACCGTGAGGGACTGCACGTCGATAAATGACAGCGTACTCCA
T
CAGATTGGAATATCACCTACTGGACACCGTAGGAGGATACTGAAACAGTTACAAATGATCTTTTCAAAA
ATG
CAAGACTTCCCCATATATGCAAATGTGCATAAGGCAAAGAACGGCAGCACCACAAAAGAGCAACAAC
AC
AGTGATCCATCTTCCAGCACCCACACCGGCATAGAGTGTTCCGATTCCATTACTGTCCATAGACCTGG
C
CCGGCACCATCAGAGATGGTTACAACCAGTACCCTTAGTGAAGGAAACTGTCAGTCTCCGAAATCACAT
GAT
AAGCTATGTCTTTCTTCACATGACCTGCTCTGTCCAGAAGAAGAACTACACCAGAACGTGGATTCTT
CG
AAAGATTCTTTATTTGGTGGTGTAAATGTCAAAATAGATCCTTTGATTACCAAGAGGGCTGTGGAGTA
C
ACAGCTGGAGAAGAACACACAGAAAAAGGCAATTTGACCTCAGAAGATTCCAGCAAGGCACTTAGTACA
AAC
ACTGAATGTCTTCCCTCTGGGGACTGTCCAACATCAGGCACACATTCTGGAAACGGGACGAATGGCG
TA
TTAGAAAGCTTCCCGCCAACCCCGTTCTTTCAGTTTCAGGGCGAGATGGTTGTGAATGAACTGTACGT
T
CCGTCCTCACCAGTCCACGGCCCCATGAGAAGCCGGAGCAAGTTGGTTTCCAGACCTTCTCGATCATTT
CTA
CTGAGACATCGCCCTGTACCAGAGATCCCAGGGTCTACAAAATCAATTCCAGGGAGCTATTTCCGTG
AC
AGAAGAAGTAATACTACCTCAGCTGGAAAGTCTTTGACACTGAAAAATTCAAATGAGGATAATTCAAC
T
TCCATCTTTCCTTACGGAGAGACATTTCTCTTCCAGAGACTAGAAAGTTCCAAGAAGCGATCTATAAAG
AAT
GAGTTTTGGCCGCATGAGAACACAGTTAAAGAGGAAGCAGCCACTACAAGAAACTCTATCCTAACCC
AG
TCAAGCATATATGATAACAGGAAGGAAAAAGTGAGTGAAGACAAAGTCGAAGACATTTGGATACCCCG
C
GAGGATAAAAATAACCTTGCACAGGATTCGGCTTCTGAGTCAGAATACTCCACAGTAGAGGAATGCTTC
CAG
AGTTTAAGAAGAAAAAATTCTAAAGCGTCCAAGTCTAGGACTCAAAAAGCCTTCTACTTGGACCCCT
TC
AATAGGCACAGTTATCCTTTAAGCTCCACGAGTGGAAATACTGAACCGTCATCAACCATCTCAAATGC
C
ATCTCTCCCTATGCCTGCTTCTATGGATCTTCAGCAGCCAAGGAGAAATGTGGATGGCTGGACAAACTC
TCT
CCTCAAGGAAAACGCATGTTTCAGAAGAGATGGGTGAAATTTGATGGCCTTAGCATTTCTTACTACA
AT
AATGACAGAGAGATGTACTCAAAAGGAATAATTCCCCTCACGGCGATATCCACAGTCCGGGCTCAAGG
A
GACAACAAATTTGAAATTGTTACAACACAAAGGACTTTTGTTTTTAGAGTAGAAAAAGAAGAAGAGAGA
AAT
GATTGGATTAGCATATTATTAAGTGCACTGAAGTCACCATCACTTGCATCACAGTTGCAAGCAGCTG
TA
GCCCCTGAGAAATGTGGATATCTTGAATTGAGAGGGTATAAAGCCAAAATTTTTACCGTGTTAAGGGG
C
AACAGTGTGTGGCTTTGCAAAAATGAACAGGATTTTAAGAGTGGACTCGGTATTACCATAATTCCCATG
AAT
GTTGCAAATGTGAAGCAAGTAGATCGAGCTGTGAAACAGTCTTTTGAGATAATTACTCCCTACCGGA
GT
TTCAGCTTCACAGCAGATTCGGAGAGAGAGAAACAGGAGTGGATTGAAGCTGTGCAGCAGTCAATAGC
A
GAGACTCTCTCTGATTATGAAGTGGCGGAGAAGATTTGGTTTAATGAGTCCAACAGGAGCTGTGCAGAT
TGT
AAAGCCCCAGATCCTGACTGGGCATCCATCAATCTCTGTGTCGTCATCTGTAAGAAGTGTGCAGGAC
AA
CATAGATCGTTGGGACCAAAAGACTCTAAAGTTAGAAGTCTGAAAATGGATGCCAGTATTTGGAGCAA
T
GAGCTCATTGAGCTATTTATTGTCATTGGAAACAAGAGAGCAAATGACTTTTGGGCTGGAAACCTTCAA
AAA
GACGAAGAATTACAGGTGGATTCCCCAGTGGAAAAGAGAAAAAACTTTATTACCCAGAAATACAAAG
AA
GGAAAATTTAGAAAGACTCTCTTAGCATCTCTGACTAAAGAAGAGTTAAATAAGGCTCTGTGTGCTGC
A
GTTGTGAAGCCAGATGTGCTGGAAACAATGGCCCTGCTGTTCAGTGGAGCAGATGTCATGTGTGCGACA
GGA
GACCCCGTGCACAGTACCCCCTACCTGCTGGCCAAGAAGGCTGGGCAGAGTCTGCAGATGGAATTTC
TC
TACCATAACAAGTTCTCAGATTTTCCTCAGTACGATGCTCATTTTGAGGGAGGGTCAAGTCAGGATGC
T
GCCCAATCCTCCTTCCTCTGCGACTTCTTATACCAGACTGCTGCCGCTGCCTCTCGGGTCTCCTCGGAG
AAG
AAGCTTCTTGAAGACACAAATAAAAAATGGTGTGTTTTGGAAGGCGGCTTCTTGAGTTACTATGAAA
AC
GACAGGTGCACCACACCTAATGGTACCATTAATATCAGTGAAGTTATCTGCCTGGCTGTCCATAAGGA
G
GACTTCTATCTGAATACTGGGCCCATCTTTGTCTTTGAAATCTACTTACCATCAGAACGTGTCTTTTTG
TTT
GGAGCTGAAACATCTCAGATTCAAAGAAAATGGACAGAGACAATAGCCAAGCGTTTTGTTCCCTTTG
TT
GCTGAAAACTTAACAGAAGCTGACTATGATCTGATTGGTCAACTCTTCTACAAAGACTGCCATGCCCT
G
GACCAGTGGAGAAAAGGCTGGTTTGCTATGGACAAGTCTAGCTTGTGTTTTTGCCTTCAAACGCAAGAA
GCT
CAGGAAGAGAGGATGAACCTAAGAAGACTGCAGGAGCTAACAATCAGCACAATGGTTCAAAATGGAG
AA
AAAGTAGATGTGTTACTCTTGGTAGAAAAGGGGAGAACACTGTACATCCATGGGCACACCAAGTTGGA
T
TTCACAGTCTGGCATACTGCAATTGAAAAAGCAGCAGGTACAGATGGTAACGCATTACAAGATCAGCAG
CTC
TGCAAGAATGACGTCCCCATTATTGTGAACAGCTGCATAGCATTTGTTACACAGTATGGGTTAGGAT
GC
AAATACATTTATCAAAAGGATGGTGATCCTTTGCACATAAGTGAACTCCTGGAGAGTTTCAAGAAGGA
T
GCCAGGAGTGTTAAGTTGCGAGCTGGGAAACATCAACTTGAAGATGTGACAGGCGTGCTGAAGAGTTTT
CTG
TCGGACATTGATGACGCTCTCCTCACGAAGGAGCTCTATCCATACTGGGTCTCTGCATTAGATACAC
AA
GATGAAAAGGAGAGAACTAGCAAGTACAGAGCCTTTATACGCTCTCTTCCTGGGGTCAACAGAGCAAC
A
CTTGCGGCTCTAATTGAACACCTTTACAGGGTTCAGAAATGCTCAGAAATCAATCACATGAATGCCCAT
AAC
TTGGCAATGGTCTTTTCATCCTGCTTATTTCAAACTAAGGGACAAACTAGTGAAGAAGTCAATGTAA
TT
GAAGATCTAATTAATAATTACGTGGAGATATTTGAGGTTAAAGAAGACCAAGTCAAACAAATGGACAT
A
GAAAATAGCTTTATAACCAAGTGGAAAGACACTCAAGTGTCCCAGGCTGGAGACTTGTTAATTGAAGTG
TTT
GTGGAAAGAAAGGAGCCAGACTGTAGTATTATAATCCGGATATCTCCTGTGATGGAAGCTGAAGAGT
TA
ACGAATGATATATTAGCGATAAAAAATATCATTCCTATGAAAGGGGATATTTGGGCCACCTTTGAAGT
C
ATTGAAAATGAAGAGCTAGAACGTCCACTTCACTACACAGAGAATGTGTTGGAGCAGGTGCTTCAGTGG
AGT
TCATTAGCTGAGCCTGGTTCTGCGTATCTTGTGGTGAAGAGATTCTTAACCATTGACAGCATTAAAC
AG
TGCAGAGAGAAAAGTATCAAAGAAGGCATCTTAAAACTCAAAGAAGAACCATCTAAAATACTGTCTGG
G
AATAAATTTCAAGATCGATGTGTTGTTTTACGAGATGGGCATCTCTTTATTTACAAGGATCCAAAGAGC
AGC
AAACACGACAAGATGTTTCCTCTTAGGGCGATGAAGTTTTATCTTGGTGTAAAAAAGAAAATGAAAC
CC
CCAACAAGTTGGGGATTGACTGTGTATTCTGAAAAACATCACTGGCACCTGTGTTGTGACAGTTTACA
A
GCCCAGATGGAGTGGATGGCCAGTATCTTCATTGCTCAGCATGAGAATGATATATGGCCGCCAGCTGGA
AAG
GAACGGAAACGTTCAATAACCAAAAATCCCAAGATTGGAGGTTTACCTCTGATTCCTATCCAACATG
AG
AGAAATGCGACCCAGGCCCGTAAGAATATTGAGACGGCCAGAGCAGAGCTTGAAAGGCTGCGGCTGAG
T
GAAAAGCACGATCCTCGAGACTTTACGGACTCCAGCTTAAAAGACCGAGCCTCCCTCATAGCCCACTGC
TTG
GAGCACAAGGATGAGAAACTCCGAAATCGTGCCAGAAAACATCGCAGTTTCAACTGCCTGGAAGACA
CC
GAGGCAGAGGGCCCACATGGCCTGCCAAAGGCCTATAAAGGTCCGAAGACACTGAAGAAGACAGAGGA
A
AGAAACAGCAAAGCTACCTTAGACGCAGATCCTAAGCTGCCATCGAAGGTCATCGAGGAACTCAGTGTG
GTT
CTCCAGAGGTCACGACCCCTTCACAAAGAGCTACCGGATGAACAGACGCTACAGAAAGAAGTAAAAT
AA


Translation (1703 aa):
MSSVSEVNADIRDFLMSINLEQYLLHFREFGFYTVRDCTSINDSVLHQIGISPTGHRRRILKQLQMIFSK
M
QDFPIYANVHKAKNGSTTKEQQHSDPSSSTHTGIECSDSITVHRPGPAPSEMVTTSTLSEGNCQSPKSH
D
KLCLSSHDLLCPEEELHQNVDSSKDSLFGGVNVKIDPLITKRAVEYTAGEEHTEKGNLTSEDSSKALST
N
TECLPSGDCPTSGTHSGNGTNGVLESFPPTPFFQFQGEMVVNELYVPSSPVHGPMRSRSKLVSRPSRSF
L
LRHRPVPEIPGSTKSIPG
SYFRDRRSNTTSAGKSLTLKNSNEDNSTSIFPYGETFLFQRLESSKKRSIK
N
EFWPHENTVKEEAATTRNSILTQS
SIYDNRKEKVSEDKVEDIWIPREDKNNLAQDSASESEYSTVEECF
Q
SLRRKNSKASKSRTQKAFYLDPFNRHSYPLSSTSGNTEPSSTISNAISPYACFYGSSAAKEKCGWLDKL
S
PQ
GKRMFQKRWVKFDGLSISYYNNDREMYSKGIIPLTAISTVRAQGDNKFEIVTTQRTFVFRVEKEEER
N
DWISILLSALKSPSLASQLQAAVAPEKCGYLELRGYKAKIFTVLRGNSVWLCKNEQ
DFKSGLGITIIPM
N
VANVKQVDRAVKQSFEIITPYRSF
SFTADSEREKQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCAD
C
KAPDPDWASINLCVVICKKCA
GQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQ
K
DEELQVDSPVEKRKNFITQKYKEGKFRKTLLASLTKEELNK
ALCAAVVKPDVLETMALLFSGADVMCAT
G
DPVHSTPYLLAKKAGQSLQMEFLYHNKFS
DFPQYDAHFEGGSSQDAAQSSFLCDFLYQTAAAASRVSSE
K
KLLE
DTNKKWCVLEGGFLSYYENDRCTTPNGTINISEVICLAVHKEDFYLNTGPIFVFEIYLPSERVFL
F
GAETSQIQRKWTETIAK
RFVPFVAENLTEADYDLIGQLFYKDCHALDQWRKGWFAMDKSSLCFCLQTQE
A
QEERMNLRRLQEL
TISTMVQNGEKVDVLLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQ
L
CKNDVPIIVNSCIAFVTQY
GLGCKYIYQKDGDPLHISELLESFKKDARSVKLRAGKHQLEDVTGVLKSF
L
SDIDDALLTKELYPYWVSAL
DTQDEKERTSKYRAFIRSLPGVNRATLAALIEHLYRVQKCSEINHMNAH
N
LAMVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFE
VKEDQVKQMDIENSFITKWKDTQVSQAGDLLIEV
F
VERKEPDCSIIIR
ISPVMEAEELTNDILAIKNIIPMKGDIWATFEVIENEELERPLHYTENVLEQVLQW
S
SLAEPGSAYLVVKRFLTIDSIKQCR
EKSIKEGILKLKEEPSKILSGNKFQDRCVVLRDGHLFIYKDPKS
S
KHDKMFPLRAMKFYLGVKKKMKPPT
SWGLTVYSEKHHWHLCCDSLQAQMEWMASIFIAQHENDIWPPAG
K
ERKRSITKNPKIGGLPLIPIQHERNATQARKNIE
TARAELERLRLSEKHDPRDFTDSSLKDRASLIAHC
L
EHKDEKLRNRARKHRSFNCLEDTEAEGPHGLPKAYKGPKTLKKTEERNSKATLDADPKLPSKVIEELSV
V
LQRSRPLHKELPDEQTLQKEVK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser