NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS51945.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51945.1 Public Mus musculus 6 Strap 23 108 98 CCDS HistoryNCBI Gene:20901Re-query CCDS DB by CCDS ID:51945.1Re-query CCDS DB by GeneID:20901See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 51945.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000064910.6 ENSMUSP00000068267.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000064910.6Link to Ensembl Protein Viewer:ENSMUSP00000068267.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000064910Re-query CCDS DB by Protein ID:ENSMUSP00000068267
Original member Current member NCBI NM_011499.3 NP_035629.2 Accepted alive Link to Nucleotide Sequence:NM_011499.3Link to Protein Sequence:NP_035629.2Re-query CCDS DB by Nucleotide ID:NM_011499Re-query CCDS DB by Protein ID:NP_035629Link to BLAST:NP_035629.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035629.2 350 Q9Z1Z2 350 100% 0 0

Chromosomal Locations for CCDS 51945.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 137735355 137735466 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137736330 137736465 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137739358 137739439 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137739755 137739827 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137741303 137741399 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137741952 137742089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137745507 137745643 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137748687 137748836 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137749364 137749429 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 137750551 137750612 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1053 nt):
ATGGCCATGAGGCAGACGCCGCTCACTTGCTCGGGCCACACGCGGCCCGTGGTGGATTTGGCCTTCAGCG
GC
ATCACGCCTTACGGCTACTTTCTGATCAGCGCTTGCAAAGATGGCAAGCCCATGCTCCGCCAGGGAGA
T
ACAGGAGACTGGATTGGAACATTTTTGGGTCATAAAGGTGCTGTTTGGGGTGCAACATTGAATAAGGAT
GCC
ACCAAAGCTGCGACAGCAGCTGCAGACTTCACAGCCAAAGTATGGGATGCGGTCTCAGGAGATGAAT
TG
ATGACCCTGGCTCATAAGCACATTGTCAAGACTGTGGATTTCACACAGGATAGCAATTACCTGCTAAC
T
GGGGGACAGGATAAACTGCTGCGCATATATGACTTGAACAAACCTGAAGCAGAACCTAAGGAAATCAGT
GGC
CACACTTCTGGTATTAAAAAGGCTCTGTGGTGCAGTGACGATAAACAGATCCTTTCAGCGGATGATA
AA
ACTGTTCGGCTCTGGGATCATGCCACAATGACAGAAGTGAAATCTCTGAATTTTAATATGTCTGTTAG
C
AGCATGGAGTATATTCCTGAAGGAGAGATTTTGGTTATTACTTATGGACGATCTATTGCTTTTCATAGT
GCA
GTAAGTCTGGAGCCAATTAAATCCTTTGAAGCTCCTGCGACCATCAATTCTGCGTCTCTTCATCCAG
AG
AAGGAGTTTCTTGTTGCGGGTGGAGAAGACTTTAAACTGTACAAGTATGATTATAACAGTGGAGAAGA
G
TTAGAATCCTACAAAGGTCACTTTGGTCCCATTCACTGTGTGAGATTCAGTCCTGATGGGGAACTCTAT
GCC
AGCGGTTCTGAAGATGGGACATTGAGATTGTGGCAAACTGTGGTAGGAAAGACCTATGGCCTGTGGA
AA
TGCGTGCTTCCTGAGGAAGACAGCGGGGAACTGGCAAAGCCAAAGATCGGATTTCCAGAAACAGCAGA
G
GAAGAGCTGGAAGAAATTGCTTCAGAGAATTCAGATTCCATCTATTCATCAACTCCTGAAGTTAAGGCC
TGA


Translation (350 aa):
MAMRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKD
A
TKAATAAADFT
AKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEIS
G
HTSGIKKALWCSDDKQILSADDKTV
RLWDHATMTEVKSLNFNMSVSSMEYIPEGEILVITYGRSIAFHS
A
V
SLEPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELY
A
SGSEDGTLRLWQTVVGKTYGLWKCVLP
EEDSGELAKPKIGFPETAEEELEEIASENSDSIYSSTPEVKA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser