NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS55828.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55828.1 Public Homo sapiens 12 NR4A1 22 109 92 CCDS HistoryNCBI Gene:3164Re-query CCDS DB by CCDS ID:55828.1Re-query CCDS DB by GeneID:3164See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 9, NCBI annotation release 37.3, Ensembl annotation release 64

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 55828.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000360284.7 ENSP00000353427.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000360284.7Link to Ensembl Protein Viewer:ENSP00000353427.3Re-query CCDS DB by Nucleotide ID:ENST00000360284Re-query CCDS DB by Protein ID:ENSP00000353427
Original member Current member EBI ENST00000550082.5 ENSP00000449539.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000550082.5Link to Ensembl Protein Viewer:ENSP00000449539.1Re-query CCDS DB by Nucleotide ID:ENST00000550082Re-query CCDS DB by Protein ID:ENSP00000449539
Original member NCBI NM_001202233.1 NP_001189162.1 Updated not alive Link to Nucleotide Sequence:NM_001202233.1Link to Protein Sequence:NP_001189162.1Re-query CCDS DB by Nucleotide ID:NM_001202233Re-query CCDS DB by Protein ID:NP_001189162
Current member NCBI NM_001202233.2 NP_001189162.1 Accepted alive Link to Nucleotide Sequence:NM_001202233.2Link to Protein Sequence:NP_001189162.1Re-query CCDS DB by Nucleotide ID:NM_001202233Re-query CCDS DB by Protein ID:NP_001189162Link to BLAST:NP_001189162.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001189162.1 611 P22736-2 611 100% 0 0

Chromosomal Locations for CCDS 55828.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 52041893 52041929 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52054327 52055204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52056030 52056159 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52056494 52056645 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52057057 52057259 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52057352 52057530 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52058688 52058944 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1836 nt):
ATGTGGTTGGCCAAGGCCTGTTGGTCCATCCAGAGTGAGATGCCCTGTATCCAAGCCCAATATGGGACAC
CA
GCACCGAGTCCGGGACCCCGTGACCACCTGGCAAGCGACCCCCTGACCCCTGAGTTCATCAAGCCCAC
C
ATGGACCTGGCCAGCCCCGAGGCAGCCCCCGCTGCCCCCACTGCCCTGCCCAGCTTCAGCACCTTCATG
GAC
GGCTACACAGGAGAGTTTGACACCTTCCTCTACCAGCTGCCAGGAACAGTCCAGCCATGCTCCTCAG
CC
TCCTCCTCGGCCTCCTCCACATCCTCGTCCTCAGCCACCTCCCCTGCCTCTGCCTCCTTCAAGTTCGA
G
GACTTCCAGGTGTACGGCTGCTACCCCGGCCCCCTGAGCGGCCCAGTGGATGAGGCCCTGTCCTCCAGT
GGC
TCTGACTACTATGGCAGCCCCTGCTCGGCCCCGTCGCCCTCCACGCCCAGCTTCCAGCCGCCCCAGC
TC
TCTCCCTGGGATGGCTCCTTCGGCCACTTCTCGCCCAGCCAGACTTACGAAGGCCTGCGGGCATGGAC
A
GAGCAGCTGCCCAAAGCCTCTGGGCCCCCACAGCCTCCAGCCTTCTTTTCCTTCAGTCCTCCCACCGGC
CCC
AGCCCCAGCCTGGCCCAGAGCCCCCTGAAGTTGTTCCCCTCACAGGCCACCCACCAGCTGGGGGAGG
GA
GAGAGCTATTCCATGCCTACGGCCTTCCCAGGTTTGGCACCCACTTCTCCACACCTTGAGGGCTCGGG
G
ATACTGGATACACCCGTGACCTCAACCAAGGCCCGGAGCGGGGCCCCAGGTGGAAGTGAAGGCCGCTGT
GCT
GTGTGTGGGGACAACGCTTCATGCCAGCATTATGGTGTCCGCACATGTGAGGGCTGCAAGGGCTTCT
TC
AAGCGCACAGTGCAGAAAAACGCCAAGTACATCTGCCTGGCTAACAAGGACTGCCCTGTGGACAAGAG
G
CGGCGAAACCGCTGCCAGTTCTGCCGCTTCCAGAAGTGCCTGGCGGTGGGCATGGTGAAGGAAGTTGTC
CGA
ACAGACAGCCTGAAGGGGCGGCGGGGCCGGCTACCTTCAAAACCCAAGCAGCCCCCAGATGCCTCCC
CT
GCCAATCTCCTCACTTCCCTGGTCCGTGCACACCTGGACTCAGGGCCCAGCACTGCCAAACTGGACTA
C
TCCAAGTTCCAGGAGCTGGTGCTGCCCCACTTTGGGAAGGAAGATGCTGGGGATGTACAGCAGTTCTAC
GAC
CTGCTCTCCGGTTCTCTGGAGGTCATCCGCAAGTGGGCGGAGAAGATCCCTGGCTTTGCTGAGCTGT
CA
CCGGCTGACCAGGACCTGTTGCTGGAGTCGGCCTTCCTGGAGCTCTTCATCCTCCGCCTGGCGTACAG
G
TCTAAGCCAGGCGAGGGCAAGCTCATCTTCTGCTCAGGCCTGGTGCTACACCGGCTGCAGTGTGCCCGT
GGC
TTCGGGGACTGGATTGACAGTATCCTGGCCTTCTCAAGGTCCCTGCACAGCTTGCTTGTCGATGTCC
CT
GCCTTCGCCTGCCTCTCTGCCCTTGTCCTCATCACCGACCGGCATGGGCTGCAGGAGCCGCGGCGGGT
G
GAGGAGCTGCAGAACCGCATCGCCAGCTGCCTGAAGGAGCACGTGGCAGCTGTGGCGGGCGAGCCCCAG
CCA
GCCAGCTGCCTGTCACGTCTGTTGGGCAAACTGCCCGAGCTGCGGACCCTGTGCACCCAGGGCCTGC
AG
CGCATCTTCTACCTCAAGCTGGAGGACTTGGTGCCCCCTCCACCCATCATTGACAAGATCTTCATGGA
C
ACGCTGCCCTTCTGA


Translation (611 aa):
MWLAKACWSIQSEMPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFM
D
GYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSS
G
SDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTG
P
SPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRC
A
VCGDNASCQHYGVRTCEGCKGFFK
RTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVV
R
TDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSK
FQELVLPHFGKEDAGDVQQFY
D
LLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAY
RSKPGEGKLIFCSGLVLHRLQCAR
G
FGDWIDSILAFSRSLHSLLVDVPAFACLSALVLIT
DRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQ
P
ASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser