NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS56965.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56965.1 Public Mus musculus 14 Elp3 23 108 98 CCDS HistoryNCBI Gene:74195Re-query CCDS DB by CCDS ID:56965.1Re-query CCDS DB by GeneID:74195See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 56965.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000022609.6 ENSMUSP00000022609.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022609.6Link to Ensembl Protein Viewer:ENSMUSP00000022609.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000022609Re-query CCDS DB by Protein ID:ENSMUSP00000022609
Original member Current member NCBI NM_001253812.1 NP_001240741.1 Accepted alive Link to Nucleotide Sequence:NM_001253812.1Link to Protein Sequence:NP_001240741.1Re-query CCDS DB by Nucleotide ID:NM_001253812Re-query CCDS DB by Protein ID:NP_001240741Link to BLAST:NP_001240741.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001240741.1 566 Q9CZX0-2 566 100% 0 0

Chromosomal Locations for CCDS 56965.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 65531524 65531600 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65547134 65547215 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65547866 65548093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65549420 65549485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65551385 65551475 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65560121 65560314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65563252 65563378 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65565312 65565473 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65577925 65578079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65580748 65580816 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65582115 65582178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65582890 65582960 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65586258 65586396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65590506 65590605 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65592925 65593000 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1701 nt):
ATGAGGCAAAAGAGGAAAGGTGCAAAATACGTGGGACAAGGGCGCAAGGGAGGAAGTGGATTCTCTGAGA
TC
ACAGGGGACCTCAGCCCGGCTGAGCTGATGATGCTGACTATAGGAGACGTTATCAAGCAGCTGGTTGA
A
GCTCATGAGCAGGGGAAAGACGTCGATCTAAATAAGATGAAAACCAAGACAGCTGCCAAGTATGGCCTT
GCG
TCCCAGCCCCGCCTGGTGGATATCATCGCTGCAGTCCCTCCTCACTATCGAAAGATCTTGATTCCTA
AG
CTAAAGGCGAAGCCCGTCAGGACTGCCAGTGGGATCGCTGTTGTGGCTGTGATGTGCAAACCCCACAG
A
TGTCCACACATCAGTTTCACAGGGAATATATGTATATACTGCCCCGGAGGACCTGACTCCGATTTTGAG
TAT
TCAACCCAGTCTTACACGGGCTATGAGCCAACTTCCATGAGAGCTATCCGTGCTAGATATGACCCTT
TT
CTGCAGACAAGACACCGGATAGAGCAGCTAAAGCAGCTTGGTCACAGTGTGGATAAGGTGGAGTTCAT
C
GTGATGGGTGGAACGTTCATGGCCCTTCCAGAAGAGTACAGAGATTATTTCATCCGAAGTTTACACGAT
GCT
TTATCAGGCCATACTTCAAACAATATTCACGAGGCAATCAAGTATTCTGAGAGAAGCTTCACAAAGT
GT
GTTGGAATTACAATTGAGACCAGACCTGATTATTGCATGAAGCGGCACCTAAGTGACATGTTGACTTA
T
GGCTGCACAAGGCTGGAGATCGGAGTGCAGAGTGTCTATGAAGATGTGGCCAGAGATACCAACAGGGGC
CAT
ACTGTGAAGGCAGCGTGTGAATCTTTCCACCTGGCCAAAGATTCTGGTTTCAAAGTGGTGACGCATA
TG
ATGCCTGACCTGCCGAACGTGGGACTGGAGAGAGACATTGAGCAGTTTATAGAATTTTTCGAGAACCC
T
GCTTTTCGTCCTGATGGTTTGAAGCTCTACCCAACCCTGGTTATCCGTGGAACTGGTCTGTATGAGCTG
TGG
AAATCAGGAAGGTACAGGAGCTATTCTCCCAGTGACCTGATTGAGCTGGTGGCTCGGATCCTAGCCC
TT
GTGCCCCCGTGGACTCGTGTGTACCGGGTGCAGAGAGACATCCCAATGCCCCTTGTCAGCTCAGGAGT
G
GAGCATGGCAACCTGCGCGAGCTGGCATTTGCAAGAATGAAGGATCTTGGAATACAGTGCCGTGATGTG
AGA
ACCAGGGAGGTTGGAATCCAAGAAATTCATCACAGAGTGCGGCCATACCAGGTCGAGTTGGTACGGA
GA
GATTATGTTGCCAATGGTGGCTGGGAAACTTTCCTGTCCTACGAAGATCCTGATCAGGACATTCTGAT
T
GGCCTCCTAAGGCTGCGGAAGTGCTCTGAGGAAACCTTCCGGTTTGAACTGGGTGGAGGTGTTTCCATA
GTC
CGAGAGCTACACGTGTATGGAAGTGTGGTCCCTGTGAGCAGCCGGGATCCCACTAAATTTCAGCATC
AG
GGGTTCGGCATGCTGCTGATGGAAGAGGCAGAGAGAATCGCTCGGGAAGAGCATGGATCTGGGAAAAT
G
GCAGTTATATCAGGGGTCGGCACAAGAAATTATTACCGAAAGATTGGCTACAGATTACAAGGCCCCTAC
ATG
GTAAAGATGCTAAAATAA


Translation (566 aa):
MRQKRKGAKYVGQGRKGGSGFSEITGDLSPAELMMLTIGDVIKQLVEAHEQGKDVDLNKMKTKTAAKYGL
A
SQPRLVDIIAAVPPHYRKILIPKLKAKPVRTASG
IAVVAVMCKPHRCPHISFTGNICIYCPGGPDSDFE
Y
STQSYTGYE
PTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRSLHD
A
LSGHTSNNIHEAI
KYSERSFTKCVGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDVARDTNRG
H
TVKAACESFHLAKDSGFKVVTHMMPDLPNVGLERDIEQFI
EFFENPAFRPDGLKLYPTLVIRGTGLYEL
W
KSGRYRSYSPSDLIELVARILALVPPWTRVYRVQ
RDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDV
R
TREVGIQEIHHRVRPYQ
VELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELGGGVSI
V
RELHVYGSVVPVSSRDPTKFQHQ
GFGMLLMEEAERIAREEHGSGKMAVISGVGTRNYYRKIGYRLQGPY
M
VKMLK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser