NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS57011.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57011.1 Public Mus musculus 15 Scn8a 23 108 98 CCDS HistoryNCBI Gene:20273Re-query CCDS DB by CCDS ID:57011.1Re-query CCDS DB by GeneID:20273See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 57011.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000108908.5 ENSMUSP00000104536.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108908.5Link to Ensembl Protein Viewer:ENSMUSP00000104536.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000108908Re-query CCDS DB by Protein ID:ENSMUSP00000104536
Original member Current member EBI ENSMUST00000108910.9 ENSMUSP00000104538.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108910.9Link to Ensembl Protein Viewer:ENSMUSP00000104538.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000108910Re-query CCDS DB by Protein ID:ENSMUSP00000104538
Original member Current member NCBI NM_011323.3 NP_035453.2 Accepted alive Link to Nucleotide Sequence:NM_011323.3Link to Protein Sequence:NP_035453.2Re-query CCDS DB by Nucleotide ID:NM_011323Re-query CCDS DB by Protein ID:NP_035453Link to BLAST:NP_035453.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035453.2 1978 Q9WTU3-1 1978 99.9494% 0 1

Chromosomal Locations for CCDS 57011.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 100936325 100936600 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 100955410 100955528 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 100957029 100957118 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 100957461 100957589 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 100959603 100959694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 100969021 100969242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 100970204 100970267 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 100971520 100971661 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 100972754 100972960 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 100974423 100974716 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 100983689 100984045 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101002034 101002166 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101008053 101008291 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101011017 101011190 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101013239 101013595 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101015624 101016094 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101016481 101016598 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101017041 101017195 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101018351 101018524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101024261 101024383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101029578 101029862 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101031710 101031763 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101032185 101032322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101033478 101033582 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101035435 101035705 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101039541 101040688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5937 nt):
ATGGCAGCGCGGCTGCTCGCACCACCAGGCCCCGACAGTTTCAAGCCTTTCACCCCCGAGTCGCTGGCAA
AC
ATCGAGAGGCGCATCGCCGAGAGCAAGCTCAAGAAACCACCCAAGGCGGATGGCAGCCACCGGGAGGA
C
GATGAAGACAGCAAGCCCAAGCCAAACAGTGACCTGGAGGCGGGGAAGAGTTTGCCTTTCATCTACGGG
GAC
ATCCCGCAAGGCCTGGTTGCGGTTCCCCTGGAGGACTTTGACCCGTACTATTTGACGCAGAAAACTT
TT
GTAGTATTAAACAGAGGGAAAACTCTCTTCAGATTTAGCGCCACTCCTGCCTTGTACATTCTAAGTCC
T
TTTAACCTGATAAGAAGAATAGCTATTAAAATTTTGATACATTCAGTCTTCAGCATGATCATCATGTGC
ACC
ATCCTGACCAACTGTGTATTCATGACTTTTAGTAACCCTCCCGAATGGTCCAAGAATGTGGAGTACA
CA
TTCACAGGGATTTACACATTTGAATCACTGGTGAAAATCATCGCCAGAGGTTTCTGCATAGACGGCTT
C
ACCTTCTTACGAGACCCGTGGAACTGGTTAGACTTCAGTGTCATCATGATGGCATATGTGACAGAGTTT
GTG
GACCTGGGCAATGTCTCAGCGCTGAGAACATTCAGGGTTCTCCGAGCTTTGAAAACTATCTCTGTAA
TT
CCAGGCCTGAAGACAATCGTGGGCGCCCTCATCCAGTCTGTGAAGAAGCTGTCAGACGTGATGATCCT
G
ACGGTGTTCTGCCTGAGTGTCTTCGCCCTGATTGGCCTGCAGCTCTTCATGGGGAACCTTCGAAACAAG
TGT
GTCGTGTGGCCCATAAACTTCAACGAGAGCTATCTGGAGAACGGCACCAGAGGCTTCGACTGGGAGG
AG
TATATCAACAATAAAACAAACTTTTACATGGTCCCTGGCATGCTAGAACCCTTGCTCTGCGGGAACAG
C
TCTGACGCCGGGCAATGCCCAGAGGGGTTCCAGTGCATGAAAGCAGGAAGAAATCCCAACTACGGCTAC
ACC
AGCTTCGACACCTTCAGCTGGGCCTTCCTGGCACTGTTCCGCCTCATGACTCAGGACTACTGGGAGA
AC
TTATACCAGCTGACCTTACGAGCGGCTGGGAAAACGTACATGATCTTCTTTGTCTTGGTGATCTTCGT
G
GGTTCTTTCTATTTGGTGAACTTGATCTTGGCTGTGGTGGCCATGGCTTACGAAGAGCAGAACCAGGCA
ACA
CTGGAGGAGGCAGAGCAGAAAGAGGCAGAGTTCAAGGCGATGCTGGAGCAGCTCAAGAAGCAGCAGG
AG
GAGGCGCAGGCTGCTGCAATGGCCACTTCGGCGGGCACCGTCTCAGAAGATGCCATTGAAGAAGAAGG
G
GAAGATGGGGTAGGCTCTCCGAGGAGCTCATCTGAGCTGTCTAAACTCAGTTCCAAGAGCGCGAAGGAG
CGT
CGGAACCGACGGAAGAAGAGGAAGCAGAAGGAGCTCTCTGAAGGGGAGGAGAAGGGGGACCCCGAGA
AG
GTGTTTAAGTCAGAGTCGGAAGATGGCATGAGAAGGAAGGCCTTCCGGCTGCCAGACAATAGGATAGG
G
AGGAAATTTTCCATCATGAATCAGTCGCTGCTCAGCATCCCAGGCTCGCCCTTCCTTTCCCGACACAAC
AGC
AAAAGCAGCATCTTCAGCTTTCGGGGTCCTGGACGGTTCCGGGACCCCGGTTCGGAGAACGAGTTCG
CA
GACGACGAGCACAGCACAGTGGAGGAAAGTGAGGGCCGGCGCGACTCGCTCTTCATCCCGATCCGCGC
C
CGCGAGCGCCGCAGCAGCTACAGCGGCTACAGCGGCTACAGCCAGTGCAGCCGCTCGTCGCGCATCTTC
CCC
AGCCTGCGGCGCAGCGTGAAACGCAACAGCACCGTGGACTGCAATGGCGTGGTGTCGCTCATCGGGC
CT
GGCTCGCACATCGGGCGGCTCCTGCCTGAGGCAACAACTGAGGTGGAGATTAAGAAGAAAGGCCCTGG
A
TCGCTCTTAGTCTCCATGGAACAACTCGCCTCCTACGGACGGAAGGACAGAATCAACAGTATAATGAGC
GTT
GTCACAAACACACTAGTGGAAGAGCTGGAAGAGTCTCAGAGAAAGTGCCCACCATGCTGGTATAAGT
TT
GCCAATACTTTCCTCATCTGGGAGTGTCACCCCTACTGGATAAAACTGAAGGAGATTGTGAACCTGAT
C
GTCATGGACCCTTTCGTAGACTTAGCCATAACCATCTGCATTGTCCTGAACACACTATTTATGGCAATG
GAG
CACCATCCCATGACGCCACAATTCGAACATGTCCTGGCCGTAGGGAACCTGGTGTTCACTGGGATCT
TC
ACGGCGGAAATGTTCCTGAAGCTCATAGCCATGGATCCCTACTATTACTTCCAAGAAGGCTGGAACAT
T
TTTGACGGATTTATCGTCTCCCTCAGTTTAATGGAGCTGGGCCTTGCAGACGTGGAGGGGCTCTCAGTG
CTG
CGATCTTTCCGATTGCTCCGAGTCTTCAAATTGGCCAAGTCCTGGCCCACCCTGAACATGCTGATCA
AG
ATCATTGGGAACTCCGTTGGCGCCCTGGGCAACCTGACCCTGGTGCTGGCCATCATTGTCTTCATCTT
T
GCCGTGGTGGGGATGCAGCTCTTTGGAAAGAGCTACAAGGAGTGCGTCTGTAAGATCAGCCAGGAGTGC
AAG
CTCCCGCGCTGGCACATGAACGACTTCTTCCACTCCTTCCTCATCGTCTTCCGAGTGCTGTGTGGGG
AG
TGGATCGAGACCATGTGGGATTGCATGGAAGTGGCCGGCCAGGCCATGTGCCTTATCGTGTTCATGAT
G
GTCATGGTCATCGGCAACCTGGTGGTGCTGAACTTATTTCTGGCCTTGCTTCTGAGCTCCTTCAGCGCA
GAC
AATCTGGCGGCCACGGACGACGACGGGGAAATGAACAACCTGCAGATATCGGTGATCCGGATCAAGA
AG
GGCGTGGCCTGGGCCAAAGTGAAGGTGCATGCCTTCATGCAGGCACACTTCAAGCAACGGGAGGCTGA
T
GAAGTGAAACCTTTAGACGAGCTGTATGAGAAGAAGGCCAACTGCATCGCCAACCACACCGGCGTGGAC
ATT
CACAGGAACGGCGACTTCCAGAAAAATGGAAATGGCACCACTAGCGGCATCGGCAGCAGCGTGGAGA
AG
TACATCATCGACGAGGACCACATGTCCTTCATTAACAACCCAAACCTGACCGTGCGGGTGCCCATTGC
T
GTGGGCGAGTCTGATTTCGAGAACCTCAACACAGAGGATGTTAGCAGCGAGTCAGACCCCGAAGGCAGC
AAA
GACAAACTGGACGATACCAGCTCCTCAGAAGGGAGTACCATCGACATCAAGCCTGAGGTGGAAGAAG
TC
CCAGTGGAGCAGCCTGAGGAATACTTGGATCCAGACGCCTGCTTCACGGAGGGTTGTGTCCAGAGGTT
C
AAGTGCTGCCAGGTCAACATCGAGGAAGGACTAGGCAAGTCGTGGTGGATCCTGCGGAAAACCTGCTTC
CTC
ATTGTGGAGCACAATTGGTTTGAGACCTTCATCATTTTCATGATTCTCCTCAGCAGTGGAGCCCTGG
CC
TTCGAGGACATCTACATTGAGCAGAGGAAGACCATCCGTACCATCCTGGAGTATGCGGACAAGGTCTT
C
ACCTACATCTTCATCCTGGAGATGTTGCTCAAATGGACAGCCTATGGCTTCGTCAAGTTCTTCACCAAT
GCC
TGGTGCTGGTTGGACTTCCTCATTGTGGCTGTCTCTTTAGTCAGCCTTATAGCTAATGCCCTGGGCT
AC
TCGGAACTAGGTGCCATAAAGTCCCTTAGGACCCTAAGAGCTTTGAGACCCTTAAGAGCCTTATCACG
A
TTTGAAGGGATGAGGGTGGTGGTGAACGCCTTGGTGGGCGCCATCCCCTCCATCATGAACGTGCTGCTG
GTG
TGTCTCATCTTCTGGCTGATTTTCAGCATCATGGGCGTTAACCTGTTTGCTGGGAAATACCACTACT
GC
TTCAACGAGACTTCAGAAATCCGGTTCGAAATCGACGAGGTGAACAATAAAACCGACTGTGAGAAGCT
C
ATGGAGGGCAACAACACAGAGATCCGATGGAAGAACGTCAAGATCAACTTCGACAACGTCGGGGCAGGC
TAC
CTGGCCCTTCTTCAAGTGGCAACCTTCAAAGGCTGGATGGACATCATGTATGCAGCTGTAGATTCCC
GA
AAGCCGGACGAGCAGCCTGATTATGAGGGCAACATCTACATGTACATCTACTTCGTCATCTTCATCAT
C
TTCGGCTCCTTCTTCACCCTCAACCTGTTCATCGGTGTCATCATCGACAATTTCAATCAACAGAAGAAA
AAG
TTTGGAGGTCAGGACATCTTCATGACAGAGGAACAGAAGAAGTACTACAACGCCATGAAGAAGCTAG
GC
TCCAAGAAGCCACAGAAGCCCATCCCCCGACCTTTGAACAAAATCCAAGGGATTGTCTTTGATTTCGT
C
ACGCAACAAGCCTTCGACATCGTGATCATGATGCTTATCTGCCTTAACATGGTGACCATGATGGTGGAG
ACA
GACACACAGAGCAAGCAGATGGAGAACATTCTCTACTGGATTAATCTGGTCTTCGTCATCTTCTTCA
CC
TGCGAGTGTGTGCTCAAAATGTTTGCCTTGAGACACTACTATTTCACCATTGGCTGGAACATCTTTGA
C
TTTGTGGTGGTCATTCTCTCCATTGTGGGAATGTTCCTGGCTGATATCATTGAGAAGTACTTCGTCTCC
CCG
ACCCTATTCCGCGTCATCCGATTGGCCCGCATCGGGCGCATCTTGCGTCTGATCAAGGGCGCCAAAG
GG
ATCCGCACCCTGCTCTTTGCCTTAATGATGTCGCTGCCCGCCCTGTTCAACATCGGCCTCCTGCTCTT
C
CTGGTCATGTTCATCTTCTCCATCTTTGGGATGTCCAACTTCGCGTACGTGAAGCACGAGGCCGGCATT
GAT
GACATGTTCAACTTCGAGACGTTTGGCAACAGCATGATCTGCCTGTTCCAGATCACGACCTCTGCTG
GT
TGGGATGGCTTACTGCTGCCAATCCTGAACCGCCCCCCTGACTGCAGCTTGGACAAGGAGCACCCAGG
A
AGTGGCTTCAAAGGGGACTGCGGGAACCCCTCCGTGGGCATCTTCTTCTTCGTCAGCTACATCATCATC
TCC
TTTCTGATCGTGGTAAACATGTACATTGCCATCATCTTGGAGAACTTCAGCGTAGCCACAGAGGAAA
GC
GCCGATCCTCTGAGCGAGGACGACTTCGAGACTTTCTATGAGATCTGGGAGAAGTTTGATCCTGATGC
C
ACCCAGTTCATCGAGTACTGTAAGCTGGCCGACTTTGCCGACGCCCTGGAGCATCCGCTCCGAGTACCC
AAG
CCCAACACCATCGAGCTCATCGCCATGGACCTGCCCATGGTGAGCGGAGATCGAATCCACTGCTTGG
AC
ATCCTTTTCGCCTTCACCAAGCGAGTCCTGGGAGACAGTGGGGAGTTGGACATCCTGCGGCAGCAGAT
G
GAGGAGCGGTTCGTGGCGTCCAATCCTTCCAAAGTGTCTTACGAGCCTATCACGACCACTCTGCGGCGC
AAG
CAGGAAGAGGTGTCTGCAGTGGTCTTGCAGCGTGCTTACAGGGGACACCTGGCTAGGCGGGGCTTCA
TC
TGCAGAAAGATCACTTCCAACAAGCTGGAGAATGGAGGCACCCACCGAGAGAAGAAGGAGAGCACCCC
G
TCCACAGCCTCCCTCCCCTCTTACGACAGCGTGACAAAGCCCGACAAGGAGAAGCAGCAGCGGGCAGAG
GAA
GGCAGGAGGGAAAGAGCCAAGAGGCAAAAAGAAGTCAGGGAGTCCAAGTGCTAG


Translation (1978 aa):
MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLEAGKSLPFIYG
D
IPQGLVAVPLEDFDPYYLTQK
TFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILIHSVFSMIIMC
T
ILTNCVFMTFSNPPEWSKNV
EYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMMAYVTEF
V
DLGNVSALRTFRVLRALKTISVIP
GLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNK
C
VVWPINFNESYLENGTRGFDWEEYINNK
TNFYMVPGMLEPLLCGNSSDAGQCPEGFQCMKAGRNPNYGY
T
SFDTFSWAFLALFRLMTQDYWENLYQL
TLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQA
T
LEEAEQKEAEFKAMLEQLKKQQEEAQ
AAAMATSAGTVSEDAIEEEGEDGVGSPRSSSELSKLSSKSAKE
R
RNRRKKRKQKELSEGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGRKFSIMNQ
SLLSIPGSPFLSRHN
S
KSSIFSFRGPGRFRDPGSENEFADDEHSTVEESEGRRDSLFIPIRARERRSSYSGYSGYSQCSRSSRIF
P
SLRRSVKRNSTVDCNGVVSLIGPGSHIGRLLPE
ATTEVEIKKKGPGSLLVSMEQLASYGRKDRINSIMS
V
VTNTLVE
ELEESQRKCPPCWYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLFMAM
E
HHPMTPQFEHVLAVGNL
VFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELGLADVEGLSV
L
RSFRL
LRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISQEC
K
LPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMVMVIGNLV
VLNLFLALLLSSFSA
D
NLAATDDDGEMNNLQISVIRIKKGVAWAKVKVHAFMQAHFKQREADEVKPLDELYEKKANCIANHTGVD
I
HRNGDFQKNGNGTTSGIGSSVEKYIIDEDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGS
K
D
KLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGCVQRFKCCQVNIEEGLGKSWWILRKTCF
L
IVEHNWFETFIIFMILLSSGAL
AFEDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFVKFFTN
A
WCWLDFLIVA
VSLVSLIANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLL
V
CLIFWLIFSIMGVNLFAGKYHYCFNETSEIRFEIDEVNNKTDCEKLMEGNNTEIRWKNVKINFDNVGAG
Y
LALLQV
ATFKGWMDIMYAAVDSRKPDEQPDYEGNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKK
K
FGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMVE
T
DTQSKQMENILYWINLVFVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIV
GMFLADIIEKYFVS
P
TLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEAGI
D
DMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGSGFKGDCGNPSVGIFFFVSYIII
S
FLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLRVP
K
PNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRR
K
QEEVSAVVLQRAYRGHLARRGFICRKITSNKLENGGTHREKKESTPSTASLPSYDSVTKPDKEKQQRAE
E
GRRERAKRQKEVRESKC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser