NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS57305.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57305.1 Public Mus musculus 4 Cdc42 23 108 98 CCDS HistoryNCBI Gene:12540Re-query CCDS DB by CCDS ID:57305.1Re-query CCDS DB by GeneID:12540See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 57305.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000030417.9 ENSMUSP00000030417.9 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000030417.9Link to Ensembl Protein Viewer:ENSMUSP00000030417.9Re-query CCDS DB by Nucleotide ID:ENSMUST00000030417Re-query CCDS DB by Protein ID:ENSMUSP00000030417
Original member Current member NCBI NM_001243769.1 NP_001230698.1 Accepted alive Link to Nucleotide Sequence:NM_001243769.1Link to Protein Sequence:NP_001230698.1Re-query CCDS DB by Nucleotide ID:NM_001243769Re-query CCDS DB by Protein ID:NP_001230698Link to BLAST:NP_001230698.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001230698.1 191 P60766-1 191 100% 0 0

Chromosomal Locations for CCDS 57305.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 137322530 137322619 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137328713 137328910 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137329015 137329124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137332407 137332479 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 137335975 137336079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (576 nt):
ATGCAGACAATTAAGTGTGTTGTTGTTGGTGATGGTGCTGTTGGTAAAACATGTCTCCTGATATCCTACA
CA
ACAAACAAATTCCCATCGGAATATGTACCAACTGTTTTTGACAACTATGCAGTCACAGTTATGATTGG
T
GGAGAGCCATACACTCTTGGACTTTTTGATACTGCAGGGCAAGAGGATTATGACAGACTACGACCGCTA
AGT
TATCCACAGACAGATGTTTTTCTAGTATGTTTCTCAGTGGTCTCTCCATCCTCATTTGAAAATGTGA
AA
GAAAAGTGGGTGCCTGAGATAACTCACCACTGTCCAAAGACTCCTTTCTTGCTTGTTGGGACCCAAAT
T
GATCTCAGAGATGACCCCTCTACTATTGAGAAACTTGCCAAGAACAAACAGAAGCCTATTACTCCAGAG
ACT
GCTGAAAAGCTGGCGCGGGATCTGAAGGCTGTCAAGTATGTGGAGTGCTCTGCCCTCACACAGAGAG
GT
CTGAAGAATGTGTTTGATGAGGCTATCCTAGCTGCCCTCGAGCCTCCGGAAACTCAACCCAAAAGGAA
G
TGCTGTATATTCTAA


Translation (191 aa):
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPL
S
YPQTDVFLVCFSVVSPSSFENVKEK
WVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPE
T
AEKLARDLKAVKYVECSALTQ
RGLKNVFDEAILAALEPPETQPKRKCCIF



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser