NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Thursday, September 23, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS57567.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57567.1 Public Mus musculus 7 Slco2b1 23 108 98 CCDS HistoryNCBI Gene:101488Re-query CCDS DB by CCDS ID:57567.1Re-query CCDS DB by GeneID:101488See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 57567.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000107088.7 ENSMUSP00000102703.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107088.7Link to Ensembl Protein Viewer:ENSMUSP00000102703.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000107088Re-query CCDS DB by Protein ID:ENSMUSP00000102703
Original member Current member NCBI NM_001252530.1 NP_001239459.1 Accepted alive Link to Nucleotide Sequence:NM_001252530.1Link to Protein Sequence:NP_001239459.1Re-query CCDS DB by Nucleotide ID:NM_001252530Re-query CCDS DB by Protein ID:NP_001239459Link to BLAST:NP_001239459.1

Chromosomal Locations for CCDS 57567.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 99660041 99660176 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99661104 99661224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99661518 99661582 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99662447 99662610 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99664779 99664944 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99666892 99667249 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99670950 99671043 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99682695 99682885 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99685476 99685574 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99685884 99686117 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99688863 99689025 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99690432 99690569 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99691757 99691893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 99706511 99706526 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2082 nt):
ATGGGGCCCAGAATAGGTGAGGGGCCCCGGATGCCAGACAGGAGCACCAAGACCACAATGGGCACAGAAG
AT
ATGCATGAAAGGAAAGTCAGTGTGGAGCCTCAGGACTCACATCAGGATGCACAGCCCCGCGGGATGTT
C
CACAACATCAAGTTCTTTGTCCTATGTCACAGTCTACTGCAGCTGACACAGCTCATGATCTCTGGCTAC
CTC
AAGAGCTCCATCTCCACAGTGGAAAAGCGCTTTGGGCTGTCCAGCCAGATCTCAGGGCTGCTAGCTG
CT
TTCAATGAGGTAGGGAATGTATCCTTGATCTTATTTGTGAGCTATTTCGGCAGCCGAGTGCACAGACC
C
CGGATGATCGGCTATGGGGCTCTCCTGGTGGCCACGGCAGGCCTGCTCATGGCACTCCCTCACTTCATC
TCA
GAACCATACCGCTATGACCACAGCAGCTCCGACAATAGGTCACTGGACTTTGAAGCATCCCTGTGCC
TG
CCCACGACTATGGCTCCAGCCTCTGCCCTGTCCAATGGCAGCTGTTCCAGTCACACAGAAACCAAGCA
T
CTGACCATGGTGGGGATCATGTTCGCAGCACAGACCCTGCTTGGCATCGGTGGTGTGCCCATACAGCCT
TTT
GGGATCTCCTACATTGACGACTTTGCCCACCATAGCAACTCACCCCTCTACATTGGGATCTTGTTTG
GA
ATAACCACGATGGGGCCTGGCCTGGCCTATGGGCTGGGTAGCCTCATGCTACGCCTTTATGTGGACAT
T
GACCGGATGCCAGAAGGAGGCATCAACTTGACTCCAAAAGACCCCAGATGGGTGGGTGCCTGGTGGCTG
GGC
TTCCTCATCTCTTCAGGACTGGTGGTCCTGGCTTCCAGCCCCTACTTCTTCTTCCCCAGAGAGATGC
CC
AAGGAGAAACATGAGTTTCATTTCAGGCGGAAGGTCTTGGCAAGTGCGGCCTCCACTGCCAGCAAGGG
T
GAGGACCTCTCCTCCCAGCACGAGCCTTTAAAGAAACAGGCTGGATTGGCCCAGATTGCCCCAGACTTG
ACT
TTGGTCCAGTTTGTCAAAGTCTTCCCTAGGGTGCTGCTGCGGAATCTGCGCCACCCCATCTTCTTGC
TG
GTAGTCCTGTCCCAGGTGTGCACCTCATCCATGGTAGCGGGCATGGCCACCTTCCTGCCTAAGTTCCT
G
GAACGCCAGTTTTCCATCACAGCCTCCTTTGCCAACATGCTCCTTGGCTGCCTCACTATCCCTCTGGTC
ATC
GTGGGCATCATGATGGGAGGTGTCTTAGTCAAGCGCCTCCACCTGAGCCCGGTGCAGTGCAGTGCCC
TC
TGCCTCCTCGGCTCGCTGTTGTGTCTGCTCTTCAGCGTGCCGCTCTTCTTCATTGGCTGCTCTACCCA
T
CAAATTGCAGGCATCACACAAGACCTGGGTGCCCAGCCAGGGCCAAGCCTGTTTCCTGGCTGCTCAGAG
CCC
TGCTCCTGCCAATCAGATGACTTTAACCCTGTTTGTGATACCAGTGCCTATGTGGAGTACACCACAC
CC
TGCCATGCAGGCTGCACAGGTCGTGTCGTCCAGGAGGCTCTGGGCAAAAGCCAGGTCTTCTACACCAA
C
TGCAGCTGTGTGGCAGGGAATGGCACTGTTCCTGCAGGTTCCTGTGAGTCAGCCTGCAGCCGCCTGGTG
CTG
CCCTTCATTGTCCTGTTCAGCCTGGGGGCGGGACTGGCCAGCATCACCCACACACCTTCCTTCATGC
TC
ATCCTGAGAGGTGTGAAGAAAGAAGATAAAACCCTGGCAGTGGGGATGCAGTTCATGCTCCTGAGAGT
G
CTGGCCTGGATGCCCAGCCCTGTGATCCATGGCAGTGCCATCGATACCACCTGTGTTCACTGGGCCCTG
ACC
TGTGGGCGGAGAGCTGTCTGCCGCTACTACGACCATGACCTGCTCCGAAACCGATTCATAGGCCTCC
AG
TTCTTCTTCAAAAGTGGATCCCTGGTGTGCTTTACCTTAGTTTTGGCCATCTTGAGGCAACAGAGCAG
A
GAGGCCAGCACCAGGACCACTGTAAAGAGCTCGGAACTACAACAGCTATAA


Translation (693 aa):
MGPRIGEGPRMPDRSTKTTMGTEDMHERKVSVEPQDSHQDAQPRGMFHNIKFFVLCHSLLQLTQLMISGY
L
KSSISTVEKRFGLSSQISGLLAAFNE
VGNVSLILFVSYFGSRVHRPRMIGYGALLVATAGLLMALPHFI
S
EPYRYDHSSS
DNRSLDFEASLCLPTTMAPASALSNGSCSSHTETKHLTMVGIMFAAQTLLGIGGVPIQP
F
GISYIDDFAHHSNSPLYI
GILFGITTMGPGLAYGLGSLMLRLYVDIDRMPEGGINLTPKDPRWVGAWWL
G
FLISSGLVVLASSPYFFFPREMPKEKHEFHFRRKVLASAASTASK
GEDLSSQHEPLKKQAGLAQIAPDL
T
LVQFVK
VFPRVLLRNLRHPIFLLVVLSQVCTSSMVAGMATFLPKFLERQFSITASFANMLLGCLTIPLV
I
VGIMMGGVLVKRLHLSPVQCSALCLLGSLLCLLFSVPLFFIGCSTHQIAGITQDL
GAQPGPSLFPGCSE
P
CSCQSDDFNPVCDTSAYVEYTTPCHAGCTGRVVQEALGKSQ
VFYTNCSCVAGNGTVPAGSCESACSRLV
L
PFIVLFSLGAGLASITHTPSFMLIL
RGVKKEDKTLAVGMQFMLLRVLAWMPSPVIHGSAIDTTCVHWAL
T
CGRRAVCRYYDHDLLRN
RFIGLQFFFKSGSLVCFTLVLAILRQQSREASTRTTVKSSELQQL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser