NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS6052.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6052.1 Public Homo sapiens 8 ADRA1A 22 109 92 CCDS HistoryNCBI Gene:148Re-query CCDS DB by CCDS ID:6052.1Re-query CCDS DB by GeneID:148See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6052.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000380582.7 ENSP00000369956.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000380582.7Link to Ensembl Protein Viewer:ENSP00000369956.3Re-query CCDS DB by Nucleotide ID:ENST00000380582Re-query CCDS DB by Protein ID:ENSP00000369956
Original member Current member NCBI NM_033302.3 NP_150645.2 Accepted alive Link to Nucleotide Sequence:NM_033302.3Link to Protein Sequence:NP_150645.2Re-query CCDS DB by Nucleotide ID:NM_033302Re-query CCDS DB by Protein ID:NP_150645Link to BLAST:NP_150645.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_150645.2 429 P35348-3 429 100% 0 0

Chromosomal Locations for CCDS 6052.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 26756759 26756779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 26770281 26770666 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 26864087 26864969 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1290 nt):
ATGGTGTTTCTCTCGGGAAATGCTTCCGACAGCTCCAACTGCACCCAACCGCCGGCACCGGTGAACATTT
CC
AAGGCCATTCTGCTCGGGGTGATCTTGGGGGGCCTCATTCTTTTCGGGGTGCTGGGTAACATCCTAGT
G
ATCCTCTCCGTAGCCTGTCACCGACACCTGCACTCAGTCACGCACTACTACATCGTCAACCTGGCGGTG
GCC
GACCTCCTGCTCACCTCCACGGTGCTGCCCTTCTCCGCCATCTTCGAGGTCCTAGGCTACTGGGCCT
TC
GGCAGGGTCTTCTGCAACATCTGGGCGGCAGTGGATGTGCTGTGCTGCACCGCGTCCATCATGGGCCT
C
TGCATCATCTCCATCGACCGCTACATCGGCGTGAGCTACCCGCTGCGCTACCCAACCATCGTCACCCAG
AGG
AGGGGTCTCATGGCTCTGCTCTGCGTCTGGGCACTCTCCCTGGTCATATCCATTGGACCCCTGTTCG
GC
TGGAGGCAGCCGGCCCCCGAGGACGAGACCATCTGCCAGATCAACGAGGAGCCGGGCTACGTGCTCTT
C
TCAGCGCTGGGCTCCTTCTACCTGCCTCTGGCCATCATCCTGGTCATGTACTGCCGCGTCTACGTGGTG
GCC
AAGAGGGAGAGCCGGGGCCTCAAGTCTGGCCTCAAGACCGACAAGTCGGACTCGGAGCAAGTGACGC
TC
CGCATCCATCGGAAAAACGCCCCGGCAGGAGGCAGCGGGATGGCCAGCGCCAAGACCAAGACGCACTT
C
TCAGTGAGGCTCCTCAAGTTCTCCCGGGAGAAGAAAGCGGCCAAAACGCTGGGCATCGTGGTCGGCTGC
TTC
GTCCTCTGCTGGCTGCCTTTTTTCTTAGTCATGCCCATTGGGTCTTTCTTCCCTGATTTCAAGCCCT
CT
GAAACAGTTTTTAAAATAGTATTTTGGCTCGGATATCTAAACAGCTGCATCAACCCCATCATATACCC
A
TGCTCCAGCCAAGAGTTCAAAAAGGCCTTTCAGAATGTCTTGAGAATCCAGTGTCTCTGCAGAAAGCAG
TCT
TCCAAACATGCCCTGGGCTACACCCTGCACCCGCCCAGCCAGGCCGTGGAAGGGCAACACAAGGACA
TG
GTGCGCATCCCCGTGGGATCAAGAGAGACCTTCTACAGGATCTCCAAGACGGATGGCGTTTGTGAATG
G
AAATTTTTCTCTTCCATGCCCCGTGGATCTGCCAGGATTACAGTGTCCAAAGACCAATCCTCCTGTACC
ACA
GCCCGGGGACACACACCCATGACATGA


Translation (429 aa):
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAV
A
DLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQ
R
RGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVV
A
KRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGC
F
VLCWLPFFLVMPI
GSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQ
S
SKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
T
AR
GHTPMT



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser