NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS6345.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6345.1 Public Homo sapiens 8 FBXO32 22 109 92 CCDS HistoryNCBI Gene:114907Re-query CCDS DB by CCDS ID:6345.1Re-query CCDS DB by GeneID:114907See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6345.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000517956.5 ENSP00000428205.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000517956.5Link to Ensembl Protein Viewer:ENSP00000428205.1Re-query CCDS DB by Nucleotide ID:ENST00000517956Re-query CCDS DB by Protein ID:ENSP00000428205
Original member NCBI NM_058229.3 NP_478136.1 Updated not alive Link to Nucleotide Sequence:NM_058229.3Link to Protein Sequence:NP_478136.1Re-query CCDS DB by Nucleotide ID:NM_058229Re-query CCDS DB by Protein ID:NP_478136
Current member NCBI NM_058229.4 NP_478136.1 Accepted alive Link to Nucleotide Sequence:NM_058229.4Link to Protein Sequence:NP_478136.1Re-query CCDS DB by Nucleotide ID:NM_058229Re-query CCDS DB by Protein ID:NP_478136Link to BLAST:NP_478136.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_478136.1 355 Q969P5-1 355 100% 0 0

Chromosomal Locations for CCDS 6345.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 123503373 123503462 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123504604 123504747 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123506392 123506574 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123513198 123513382 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123514240 123514333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123531898 123531990 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123533191 123533240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123534702 123534814 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123540899 123541014 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1068 nt):
ATGCCATTCCTCGGGCAGGACTGGCGGTCCCCCGGGCAGAACTGGGTGAAGACGGCCGACGGCTGGAAGC
GC
TTCCTGGATGAGAAGAGCGGCAGTTTCGTGAGCGACCTCAGCAGTTACTGCAACAAGGAGGTATACAA
T
AAGGAGAATCTTTTCAACAGCCTGAACTATGATGTTGCAGCCAAGAAGAGAAAGAAGGACATGCTGAAT
AGC
AAAACCAAAACTCAGTATTTCCACCAAGAAAAATGGATCTATGTTCACAAAGGAAGTACTAAAGAGC
GC
CATGGATATTGCACCCTGGGGGAAGCTTTCAACAGACTGGACTTCTCAACTGCCATTCTGGATTCCAG
A
AGATTTAACTACGTGGTCCGGCTGTTGGAGCTGATAGCAAAGTCACAGCTCACATCCCTGAGTGGCATC
GCC
CAAAAGAACTTCATGAATATTTTGGAAAAAGTGGTACTGAAAGTCCTTGAAGACCAGCAAAACATTA
GA
CTAATAAGGGAACTACTCCAGACCCTCTACACATCCTTATGTACACTGGTCCAAAGAGTCGGCAAGTC
T
GTGCTGGTCGGGAACATTAACATGTGGGTGTATCGGATGGAGACGATTCTCCACTGGCAGCAGCAGCTG
AAC
AACATTCAGATCACCAGGCCTGCCTTCAAAGGCCTCACCTTCACTGACCTGCCTTTGTGCCTACAAC
TG
AACATCATGCAGAGGCTGAGCGACGGGCGGGACCTGGTCAGCCTGGGCCAGGCTGCCCCCGACCTGCA
C
GTGCTCAGCGAAGACCGGCTGCTGTGGAAGAAACTCTGCCAGTACCACTTCTCCGAGCGGCAGATCCGC
AAA
CGATTAATTCTGTCAGACAAAGGGCAGCTGGATTGGAAGAAGATGTATTTCAAACTTGTCCGATGTT
AC
CCAAGGAAAGAGCAGTATGGAGATACCCTTCAGCTCTGCAAACACTGTCACATCCTTTCCTGGAAGGG
C
ACTGACCATCCGTGCACTGCCAATAACCCAGAGAGCTGCTCCGTTTCACTTTCACCCCAGGACTTTATC
AAC
TTGTTCAAGTTCTGA


Translation (355 aa):
MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLN
S
KTKTQ
YFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGI
A
QKNFMNILEKVVLK
VLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQL
N
NIQITR
PAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIR
K
RLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLCKHCHILSWK
GTDHPCTANNPESCSVSLSPQDFI
N
LFKF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser