NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS66957.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
66957.1 Public Homo sapiens 16 PDXDC1 22 109 92 CCDS HistoryNCBI Gene:23042Re-query CCDS DB by CCDS ID:66957.1Re-query CCDS DB by GeneID:23042See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 15, NCBI annotation release 105, Ensembl annotation release 74

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 66957.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000450288.3 ENSP00000391147.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000450288.3Link to Ensembl Protein Viewer:ENSP00000391147.3Re-query CCDS DB by Nucleotide ID:ENST00000450288Re-query CCDS DB by Protein ID:ENSP00000391147
Original member Current member NCBI NM_001285448.1 NP_001272377.1 Accepted alive Link to Nucleotide Sequence:NM_001285448.1Link to Protein Sequence:NP_001272377.1Re-query CCDS DB by Nucleotide ID:NM_001285448Re-query CCDS DB by Protein ID:NP_001272377Link to BLAST:NP_001272377.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001272377.1 697 Q6P996-3 697 100% 0 0

Chromosomal Locations for CCDS 66957.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 14997777 14997826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14998340 14998405 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15006394 15006583 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15008779 15008847 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15009681 15009759 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15016129 15016213 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15017120 15017168 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15017321 15017422 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15018840 15018965 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15022704 15022754 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15026643 15026706 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15028878 15028966 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15029951 15030056 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15031735 15031906 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15032861 15032979 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15033278 15033399 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15034286 15034378 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15034457 15034553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15035449 15035553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 15036016 15036275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2094 nt):
ATGGGAAAAAACTTGAAGGAGGCAGTGAAGATGCTGGAGGACAGTCAGAGAAGAACAGAAGAGGAAAATG
GA
AAGAAGCTCATATCCGGAGATATTCCAGGCCCACTCCAGGGCAGATATGAAAATGGGTGTGCTTATTT
C
CACGAAGAGGAAAGAGAAGGACTTGCAAAGATATGTAGGCTTGCCATTCATTCTCGATATGAAGACTTC
GTA
GTGGATGGCTTCAATGTGTTATATAACAAGAAGCCTGTCATATATCTTAGTGCTGCTGCTAGACCTG
GC
CTGGGCCAATACCTTTGTAATCAGCTCGGCTTGCCCTTCCCCTGCTTGTGCCGTGTACCCTGTAACAC
T
GTGTTTGGATCCCAGCATCAGATGGATGTTGCCTTCCTGGAGAAACTGATTAAAGATGATATAGAGCGA
GGA
AGACTGCCCCTGTTGCTTGTCGCAAATGCAGGAACGGCAGCAGTAGGACACACAGACAAGATTGGGA
GA
TTGAAAGAACTCTGTGAGCAGTATGGCATATGGCTTCATGTGGAGGGTGTGAATCTGGCAACATTGGC
T
CTGGGTTATGTCTCCTCATCAGTGCTGGCTGCAGCCAAATGTGATAGCATGACGATGACTCCTGGCCCG
TGG
CTGGGTTTGCCAGCTGTTCCTGCGGTGACACTGTATAAACACGATGACCCTGCCTTGACTTTAGTTG
CT
GGTCTTACATCAAATAAGCCCACAGACAAACTCCGTGCCCTGCCTCTGTGGTTATCTTTACAATACTT
G
GGACTTGATGGGTTTGTGGAGAGGATCAAGCATGCCTGTCAACTGAGTCAACGGTTGCAGGAAAGTTTG
AAG
AAAGTGAATTACATCAAAATCTTGGTGGAAGATGAGCTCAGCTCCCCAGTGGTGGTGTTCAGATTTT
TC
CAGGAATTACCAGGCTCAGATCCGGTGTTTAAAGCCGTCCCAGTGCCCAACATGACACCTTCAGGAGT
C
GGCCGGGAGAGGCACTCGTGTGACGCGCTGAATCGCTGGCTGGGAGAACAGCTGAAGCAGCTGGTGCCT
GCA
AGCGGCCTCACAGTCATGGATCTGGAAGCTGAGGGCACGTGTTTGCGGTTCAGCCCTTTGATGACCG
CA
GCAGTTTTAGGAACTCGGGGAGAGGATGTGGATCAGCTCGTAGCCTGCATAGAAAGCAAACTGCCAGT
G
CTGTGCTGTACGCTCCAGTTGCGTGAAGAGTTCAAGCAGGAAGTGGAAGCAACAGCAGGTCTCCTATAT
GTT
GATGACCCTAACTGGTCTGGAATAGGGGTTGTCAGGTATGAACATGCTAATGATGATAAGAGCAGTT
TG
AAATCAGATCCCGAAGGGGAAAACATCCATGCTGGACTCCTGAAGAAGTTAAATGAACTGGAATCTGA
C
CTAACCTTTAAAATAGGCCCTGAGTATAAGAGCATGAAGAGCTGCCTTTATGTCGGCATGGCGAGCGAC
AAC
GTCGATGCTGCTGAGCTCGTGGAGACCATTGCGGCCACAGCCCGGGAGATAGAGGAGAACTCGAGGC
TT
CTGGAAAACATGACAGAAGTGGTTCGGAAAGGCATTCAGGAAGCTCAAGTGGAGCTGCAGAAGGCAAG
T
GAAGAACGGCTTCTGGAAGAGGGGGTGTTGCGGCAGATCCCTGTAGTGGGCTCCGTGCTGAATTGGTTT
TCT
CCGGTCCAGGCTTTACAGAAGGGAAGAACTTTTAACTTGACAGCAGGCTCTCTGGAGTCCACAGAAC
CC
ATATATGTCTACAAAGCACAAGGTGCAGGAGTCACGCTGCCTCCAACGCCCTCGGGCAGTCGCACCAA
G
CAGAGGCTTCCAGGCCAGAAGCCTTTTAAAAGGTCCCTGCGAGGTTCAGATGCTTTGAGTGAGACCAGC
TCA
GTCAGTCACATTGAAGACTTAGAAAAGGTGGAGCGCCTATCCAGTGGGCCGGAGCAGATCACCCTCG
AG
GCCAGCAGCACTGAGGGACACCCAGGGGCTCCCAGCCCTCAGCACACCGACCAGACCGAGGCCTTCCA
G
AAAGGGGTCCCACACCCAGAAGATGACCACTCACAGGTAGAAGGACCGGAGAGCTTAAGATGA


Translation (697 aa):
MGKNLKEAVKMLEDSQRRTEEENGKKLISGDIPGPLQGRYENGCAYFHEEEREGLAKICRLAIHSRYEDF
V
VDGFNVLYNKKPVIYLSAAARPGLGQYLCNQ
LGLPFPCLCRVPCNTVFGSQHQMDVAFLEKLIKDDIER
G
RLPLLLVANA
GTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSVLAAAKCDSMTMTPGP
W
LGLPAVPAVTLYKHDDPAL
TLVAGLTSNKPTDKLRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESL
K
KVNYIKIL
VEDELSSPVVVFRFFQELPGSDPVFKAVPVPNMTPSGVGRERHSCDALNRWLGEQLKQLVP
A
SGLTVMDLEAEGTCLRFSPLMTAA
VLGTRGEDVDQLVACIESKLPVLCCTLQLREEFKQEVEATAGLLY
V
DDPNWSGIGVV
RYEHANDDKSSLKSDPEGENIHAGLLKKLNELESDLTFKIGPEYKSMKSCLYVGMASD
N
VDAAELVETIAATAREIEENSR
LLENMTEVVRKGIQEAQVELQKASEERLLEEGVLRQIPVVGSVLNWF
S
PVQALQKGRTFNLTA
GSLESTEPIYVYKAQGAGVTLPPTPSGSRTKQRLPGQKPFKRSLRGSDALSETS
S
VSHIEDLEKVERLSSGPEQITLEASSTEGHPGAPSPQHTDQTEAFQKGVPHPEDDHSQVEGPESLR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser