NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS6714.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6714.1 Public Homo sapiens 9 PTCH1 22 109 92 CCDS HistoryNCBI Gene:5727Re-query CCDS DB by CCDS ID:6714.1Re-query CCDS DB by GeneID:5727See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6714.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000331920.10 ENSP00000332353.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000331920.10Link to Ensembl Protein Viewer:ENSP00000332353.6Re-query CCDS DB by Nucleotide ID:ENST00000331920Re-query CCDS DB by Protein ID:ENSP00000332353
Original member NCBI NM_000264.4 NP_000255.2 Updated not alive Link to Nucleotide Sequence:NM_000264.4Link to Protein Sequence:NP_000255.2Re-query CCDS DB by Nucleotide ID:NM_000264Re-query CCDS DB by Protein ID:NP_000255
Current member NCBI NM_000264.5 NP_000255.2 Accepted alive Link to Nucleotide Sequence:NM_000264.5Link to Protein Sequence:NP_000255.2Re-query CCDS DB by Nucleotide ID:NM_000264Re-query CCDS DB by Protein ID:NP_000255Link to BLAST:NP_000255.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000255.2 1447 Q13635-1 1447 100% 0 0

Chromosomal Locations for CCDS 6714.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 95446912 95447451 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95449069 95449323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95449841 95449940 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95453478 95453620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95456276 95456413 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95458013 95458293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95459600 95459783 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95461856 95461998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95467116 95467425 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95468751 95469153 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95469813 95469931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95476034 95476159 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95476759 95476857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95477547 95477702 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95478055 95478186 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95479000 95479147 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95479969 95480090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95480390 95480588 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95481949 95482040 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95482134 95482203 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95485685 95485874 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95506407 95506599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95508161 95508361 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4344 nt):
ATGGCCTCGGCTGGTAACGCCGCCGAGCCCCAGGACCGCGGCGGCGGCGGCAGCGGCTGTATCGGTGCCC
CG
GGACGGCCGGCTGGAGGCGGGAGGCGCAGACGGACGGGGGGGCTGCGCCGTGCTGCCGCGCCGGACCG
G
GACTATCTGCACCGGCCCAGCTACTGCGACGCCGCCTTCGCTCTGGAGCAGATTTCCAAGGGGAAGGCT
ACT
GGCCGGAAAGCGCCGCTGTGGCTGAGAGCGAAGTTTCAGAGACTCTTATTTAAACTGGGTTGTTACA
TT
CAAAAAAACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGGGCCTTCGCGGTGGGATTAAA
A
GCAGCGAACCTCGAGACCAACGTGGAGGAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTA
AAT
TATACTCGCCAGAAGATTGGAGAAGAGGCTATGTTTAATCCTCAACTCATGATACAGACCCCTAAAG
AA
GAAGGTGCTAATGTCCTGACCACAGAAGCGCTCCTACAACACCTGGACTCGGCACTCCAGGCCAGCCG
T
GTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAACATTTGTGTTACAAATCAGGAGAGCTTATC
ACA
GAAACAGGTTACATGGATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTACACCTTTGGACT
GC
TTCTGGGAAGGGGCGAAATTACAGTCTGGGACAGCATACCTCCTAGGTAAACCTCCTTTGCGGTGGAC
A
AACTTCGACCCTTTGGAATTCCTGGAAGAGTTAAAGAAAATAAACTATCAAGTGGACAGCTGGGAGGAA
ATG
CTGAATAAGGCTGAGGTTGGTCATGGTTACATGGACCGCCCCTGCCTCAATCCGGCCGATCCAGACT
GC
CCCGCCACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCCCTTGTTTTGAATGGTGGATG
T
CATGGCTTATCCAGAAAGTATATGCACTGGCAGGAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGC
ACT
GGAAAACTCGTCAGCGCCCATGCCCTGCAGACCATGTTCCAGTTAATGACTCCCAAGCAAATGTACG
AG
CACTTCAAGGGGTACGAGTATGTCTCACACATCAACTGGAACGAGGACAAAGCGGCAGCCATCCTGGA
G
GCCTGGCAGAGGACATATGTGGAGGTGGTTCATCAGAGTGTCGCACAGAACTCCACTCAAAAGGTGCTT
TCC
TTCACCACCACGACCCTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATCCGCGTGGCCA
GC
GGCTACTTACTCATGCTCGCCTATGCCTGTCTAACCATGCTGCGCTGGGACTGCTCCAAGTCCCAGGG
T
GCCGTGGGGCTGGCTGGCGTCCTGCTGGTTGCACTGTCAGTGGCTGCAGGACTGGGCCTGTGCTCATTG
ATC
GGAATTTCCTTTAACGCTGCAACAACTCAGGTTTTGCCATTTCTCGCTCTTGGTGTTGGTGTGGATG
AT
GTTTTTCTTCTGGCCCACGCCTTCAGTGAAACAGGACAGAATAAAAGAATCCCTTTTGAGGACAGGAC
C
GGGGAGTGCCTGAAGCGCACAGGAGCCAGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTC
ATG
GCCGCGTTAATCCCAATTCCCGCTCTGCGGGCGTTCTCCCTCCAGGCAGCGGTAGTAGTGGTGTTCA
AT
TTTGCCATGGTTCTGCTCATTTTTCCTGCAATTCTCAGCATGGATTTATATCGACGCGAGGACAGGAG
A
CTGGATATTTTCTGCTGTTTTACAAGCCCCTGCGTCAGCAGAGTGATTCAGGTTGAACCTCAGGCCTAC
ACC
GACACACACGACAATACCCGCTACAGCCCCCCACCTCCCTACAGCAGCCACAGCTTTGCCCATGAAA
CG
CAGATTACCATGCAGTCCACTGTCCAGCTCCGCACGGAGTACGACCCCCACACGCACGTGTACTACAC
C
ACCGCTGAGCCGCGCTCCGAGATCTCTGTGCAGCCCGTCACCGTGACACAGGACACCCTCAGCTGCCAG
AGC
CCAGAGAGCACCAGCTCCACAAGGGACCTGCTCTCCCAGTTCTCCGACTCCAGCCTCCACTGCCTCG
AG
CCCCCCTGTACGAAGTGGACACTCTCATCTTTTGCTGAGAAGCACTATGCTCCTTTCCTCTTGAAACC
A
AAAGCCAAGGTAGTGGTGATCTTCCTTTTTCTGGGCTTGCTGGGGGTCAGCCTTTATGGCACCACCCGA
GTG
AGAGACGGGCTGGACCTTACGGACATTGTACCTCGGGAAACCAGAGAATATGACTTTATTGCTGCAC
AA
TTCAAATACTTTTCTTTCTACAACATGTATATAGTCACCCAGAAAGCAGACTACCCGAATATCCAGCA
C
TTACTTTACGACCTACACAGGAGTTTCAGTAACGTGAAGTATGTCATGTTGGAAGAAAACAAACAGCTT
CCC
AAAATGTGGCTGCACTACTTCAGAGACTGGCTTCAGGGACTTCAGGATGCATTTGACAGTGACTGGG
AA
ACCGGGAAAATCATGCCAAACAATTACAAGAATGGATCAGACGATGGAGTCCTTGCCTACAAACTCCT
G
GTGCAAACCGGCAGCCGCGATAAGCCCATCGACATCAGCCAGTTGACTAAACAGCGTCTGGTGGATGCA
GAT
GGCATCATTAATCCCAGCGCTTTCTACATCTACCTGACGGCTTGGGTCAGCAACGACCCCGTCGCGT
AT
GCTGCCTCCCAGGCCAACATCCGGCCACACCGACCAGAATGGGTCCACGACAAAGCCGACTACATGCC
T
GAAACAAGGCTGAGAATCCCGGCAGCAGAGCCCATCGAGTATGCCCAGTTCCCTTTCTACCTCAACGGC
TTG
CGGGACACCTCAGACTTTGTGGAGGCAATTGAAAAAGTAAGGACCATCTGCAGCAACTATACGAGCC
TG
GGGCTGTCCAGTTACCCCAACGGCTACCCCTTCCTCTTCTGGGAGCAGTACATCGGCCTCCGCCACTG
G
CTGCTGCTGTTCATCAGCGTGGTGTTGGCCTGCACATTCCTCGTGTGCGCTGTCTTCCTTCTGAACCCC
TGG
ACGGCCGGGATCATTGTGATGGTCCTGGCGCTGATGACGGTCGAGCTGTTCGGCATGATGGGCCTCA
TC
GGAATCAAGCTCAGTGCCGTGCCCGTGGTCATCCTGATCGCTTCTGTTGGCATAGGAGTGGAGTTCAC
C
GTTCACGTTGCTTTGGCCTTTCTGACGGCCATCGGCGACAAGAACCGCAGGGCTGTGCTTGCCCTGGAG
CAC
ATGTTTGCACCCGTCCTGGATGGCGCCGTGTCCACTCTGCTGGGAGTGCTGATGCTGGCGGGATCTG
AG
TTCGACTTCATTGTCAGGTATTTCTTTGCTGTGCTGGCGATCCTCACCATCCTCGGCGTTCTCAATGG
G
CTGGTTTTGCTTCCCGTGCTTTTGTCTTTCTTTGGACCATATCCTGAGGTGTCTCCAGCCAACGGCTTG
AAC
CGCCTGCCCACACCCTCCCCTGAGCCACCCCCCAGCGTGGTCCGCTTCGCCATGCCGCCCGGCCACA
CG
CACAGCGGGTCTGATTCCTCCGACTCGGAGTATAGTTCCCAGACGACAGTGTCAGGCCTCAGCGAGGA
G
CTTCGGCACTACGAGGCCCAGCAGGGCGCGGGAGGCCCTGCCCACCAAGTGATCGTGGAAGCCACAGAA
AAC
CCCGTCTTCGCCCACTCCACTGTGGTCCATCCCGAATCCAGGCATCACCCACCCTCGAACCCGAGAC
AG
CAGCCCCACCTGGACTCAGGGTCCCTGCCTCCCGGACGGCAAGGCCAGCAGCCCCGCAGGGACCCCCC
C
AGAGAAGGCTTGTGGCCACCCCCCTACAGACCGCGCAGAGACGCTTTTGAAATTTCTACTGAAGGGCAT
TCT
GGCCCTAGCAATAGGGCCCGCTGGGGCCCTCGCGGGGCCCGTTCTCACAACCCTCGGAACCCAGCGT
CC
ACTGCCATGGGCAGCTCCGTGCCCGGCTACTGCCAGCCCATCACCACTGTGACGGCTTCTGCCTCCGT
G
ACTGTCGCCGTGCACCCGCCGCCTGTCCCTGGGCCTGGGCGGAACCCCCGAGGGGGACTCTGCCCAGGC
TAC
CCTGAGACTGACCACGGCCTGTTTGAGGACCCCCACGTGCCTTTCCACGTCCGGTGTGAGAGGAGGG
AT
TCGAAGGTGGAAGTCATTGAGCTGCAGGACGTGGAATGCGAGGAGAGGCCCCGGGGAAGCAGCTCCAA
C
TGA


Translation (1447 aa):
MASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDYLHRPSYCDAAFALEQISKGKA
T
GRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVE
VGGRVSREL
N
YTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYN
RQWKLEHLCYKSGELI
T
ETGYMDQ
IIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEE
M
LNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTK
PLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNS
T
GKLV
SAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVL
S
FTTTTLDDILKSFSDVSVIRVASGYLLM
LAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSL
I
GISFNAATTQ
VLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFF
M
AALIPIPALRAFSLQ
AAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAY
T
DTHDNTRYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQ
S
PESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAK
VVVIFLFLGLLGVSLYGTTR
V
RDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQL
P
KMWLHYFRDWLQ
GLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDA
D
GIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETRLR
IPAAEPIEYAQFPFYLNG
L
RDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFLLNP
W
TAGII
VMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALE
H
MFAPVLDGAVSTLLGVLMLAGSEFDFIV
RYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGL
N
RLPTPSPEPPPSVVRFAMPPGHTHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATE
N
PVFAHST
VVHPESRHHPPSNPRQQPHLDSGSLPPGRQGQQPRRDPPREGLWPPPYRPRRDAFEISTEGH
S
GPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPITTVTASASVTVAVHPPPVPGPGRNPRGGLCPG
Y
PETDHGLFEDPHVPFHVRCERRDSKVEVIELQDVECEERPRGSSSN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser