NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS70685.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
70685.1 Public Mus musculus 16 Pdxdc1 23 108 98 CCDS HistoryNCBI Gene:94184Re-query CCDS DB by CCDS ID:70685.1Re-query CCDS DB by GeneID:94184See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 70685.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000023361.11 ENSMUSP00000023361.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023361.11Link to Ensembl Protein Viewer:ENSMUSP00000023361.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000023361Re-query CCDS DB by Protein ID:ENSMUSP00000023361
Original member Current member NCBI NM_001291017.1 NP_001277946.1 Accepted alive Link to Nucleotide Sequence:NM_001291017.1Link to Protein Sequence:NP_001277946.1Re-query CCDS DB by Nucleotide ID:NM_001291017Re-query CCDS DB by Protein ID:NP_001277946Link to BLAST:NP_001277946.1

Chromosomal Locations for CCDS 70685.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 13834814 13834846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13836386 13836615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13837043 13837147 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13838096 13838192 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13838302 13838394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13839232 13839353 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13839637 13839755 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13840287 13840458 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13843771 13843876 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13845335 13845423 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13847726 13847789 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13854395 13854445 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13857377 13857502 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13858857 13858958 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13859110 13859158 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13859954 13860038 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13869803 13869881 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13872455 13872523 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13875978 13876167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13879426 13879572 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13881878 13881958 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13884566 13884631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13887697 13887770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13902915 13902935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2370 nt):
ATGGACGCGTCCCTGGAGAAGATAGCAGACCCTACATTAGCTGAAATGGGAAAAAACTTGAAAGAGGCGA
TG
CGGATGCTGGAGAAGAGCCCGAGAAGAACAGAGGAGGAAAATGGAAAGAAGCCAGTATCTGAGGATAT
T
CCAGGGCCACTCCAAGGCAGTGGACAAGATATGGTGAGCATCCTCCAGTTAGTTCAAAATCTGATGCAT
GGA
GATGAAGATGAGGAGCCCCAGAGCACCCGAATCCAAAATATTGGAGAGCAAGGTCACATGGCTTTGT
TG
GGTCATAGCCTCGGTGCCTATATTTCAACTCTGGATAAAGAGAAGCTGAGAAAGCTCACAACCAGGAT
A
CTTTCAGACACTACCTTATGGCTACGCCGGATTTTCAGGTACGAAAATGGATGTGCATATTTCCACGAG
GAA
GAGAGGGAAGGACTTGCTAAGATCTGTAGGCTTGCCATTCATTCTCGCTATGAAGACTTTGTTGTAG
AT
GGATTCAACGTGTTATATAACAAAAAGCCTGTCATATATCTTAGTGCTGCCGCTAGACCTGGCCTGGG
C
CAATACCTTTGTAATCAGCTTGGCTTACCCTTCCCCTGCCTGTGCCGTGTGCCCTGTAACACTATGTTT
GGA
TCCCAGCATCAGATGGACGTTGCCTTTCTCGAGAAACTGATCAAAGATGACGTAGAAAGAGGAAGAC
TG
CCCTTGCTGCTTGTTGCAAATGCTGGAACTGCAGCAGTTGGACACACAGACAAGATTGGACGTTTGAA
G
GAACTCTGTGAGCAGTACGGCATTTGGCTTCATGTGGAAGGTGTGAATCTGGCAACATTGGCTCTAGGT
TAT
GTCTCCTCATCTGTGCTGGCTGCAACCAAGTGCGATAGCATGACACTAACTCCTGGCCTATGGCTAG
GT
TTGCCAGCTGTTCCTGCAGTGACACTCTACAAACATGACGATCCTGCCTTGACACTAGTTGCTGGTCT
T
ACATCAAATAAGCCTGCAGACAAACTCCGAGCCCTACCACTCTGGTTGTCTCTACAGTACTTGGGACTT
GAT
GGCATTGTGGAGAGAATAAAGCATGCTTGTCATCTGAGTCAACGGTTGCAAGAAAGTTTGAAGAAAG
TG
GACCACATCAAAATCTTGGTGGAAGATGAGCTCAGTTCTCCAGTAGTGGTGTTCAGGTTTTTCCAGGA
A
TTACCAGCCTCAGATTCAGCGTTTAAAGCTGTTCCTGTATCCAACATAGCACCTGCAGCAGTTGGCCGG
GAA
AGACACTCCTGTGATGCACTGAACCGCTGGTTGGGTGAACAGTTGAAACAGTTGGTGCCTCAGTGTG
GC
CTCACTGTCATAGACCTGGAGGTAGATGGCACATGTGTTCGGTTCAGCCCTCTGATGACAGCAGAAGG
G
TTAGGAACTCGAGGAGAGGATGTCGATCAGCTCATTACCTGCATCCAAAGCAAACTACCAGTCCTGACC
TGC
ACACTACAGCTTCGGGAAGAATTCAAGCAGGAGGTAGAGGGGACAGCAGGGCTCCTGTATGTTGATG
AC
CCCAACTGGCCTGGAATCGGGGTTGTCAGGTATGAGCATGCGAATGATGATGACACCAGTTTGAAATC
T
GATCCAGAGGGGGAAAAAATACACACTGGACTTCTGAAAAAGTTAAATGAACTGGAATCTGACCTCACA
TTT
AAAATAGGCCCTGAGTACAAAAGCATGAAGAGCTGCATTTACATTGGCATGGCAAGTGATGATGTGG
AC
GTTTCTGAGCTAGTGGAGACCATTGCAGTCACAGCCCGGGAAATTGAGGAGAACTCAAGGCTTCTAGA
G
AACATGACAGAAGTTGTTCGGAAGGGAATTCAGGAGGCACAGGTTCAGCTACAGAAGGCAAATGAGGAG
CGG
CTTCTGGAAGAGGGAGTGTTGCGGCAAATCCCTGTAGTAGGATCCGTGCTGAATTGGTTTTCTCCAG
TC
CAGGCTTCACAGAAGGGAAGAAGTTTTAACTTAACAGCAGGCTCTCTGGAGTCCACAGAATACACCTA
T
GTCCACAAAGTACAAGGTACTGGGGTGACACCACCTCCCACACCCCTAGGCACTCGAAGCAAACAGAGG
CTT
CCAGGTCAGAAGCCTTTTAAAAGGTCCCTGAGAGGCTCGGATGCTGTGAGTGAGACCAGCTCAGTCA
GC
CACATTGAAGACCTGGAAAAGGTGGAACAGCTGTCCAGTGGGCTAGAGCATGACAACCTAGAGGCCCA
C
AGCCCTGAGCAGCCTCCCAGGGCCACTGATCTCACGGCCAGACAGACTGAGGCCCTGCAGAACCAGGCC
CAG
CATCAGGAAGATGACCATTCACAGATGGGAACCAGGGTGCAGAGACTTAAGGTTTAG


Translation (789 aa):
MDASLEKIADPTLAEMGKNLKEAMRMLEKSPRRTEEENGKKPVSEDIPGPLQGSGQDMVSILQLVQNLMH
G
DEDEEPQST
RIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLRRIFRYENGCAYFHE
E
EREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQ
LGLPFPCLCRVPCNTMF
G
SQHQM
DVAFLEKLIKDDVERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALG
Y
VSSSVL
AATKCDSMTLTPGLWLGLPAVPAVTLYKHDDPALTLVAGLTSNKPADKLRALPLWLSLQYLGL
D
GIVERIKHACHL
SQRLQESLKKVDHIKILVEDELSSPVVVFRFFQELPASDSAFKAVPVSNIAPAAVGR
E
RHSCDALNRW
LGEQLKQLVPQCGLTVIDLEVDGTCVRFSPLMTAEGLGTRGEDVDQLITCIQSKLPVLT
C
TLQLREEFKQEVEGTAGLLYVDDPNWPGIGVV
RYEHANDDDTSLKSDPEGEKIHTGLLKKLNELESDLT
F
KI
GPEYKSMKSCIYIGMASDDVDVSELVETIAVTAREIEENSRLLENMTEVVRKGIQEAQVQLQKANEE
R
LLEE
GVLRQIPVVGSVLNWFSPVQASQKGRSFNLTAGSLESTEYTYVHKVQGTGVTPPPTPLGTRSKQR
L
P
GQKPFKRSLRGSDAVSETSSVSHIEDLEKVEQLSSGLEHDNLEAHSPEQPPRATDLTARQTEALQNQA
Q
HQEDDHSQ
MGTRVQRLKV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser