NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS70935.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
70935.1 Public Mus musculus 19 Ms4a7 23 108 98 CCDS HistoryNCBI Gene:109225Re-query CCDS DB by CCDS ID:70935.1Re-query CCDS DB by GeneID:109225See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 70935.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000025574.10 ENSMUSP00000025574.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000025574.10Link to Ensembl Protein Viewer:ENSMUSP00000025574.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000025574Re-query CCDS DB by Protein ID:ENSMUSP00000025574
Original member Current member NCBI NM_001276398.1 NP_001263327.1 Accepted alive Link to Nucleotide Sequence:NM_001276398.1Link to Protein Sequence:NP_001263327.1Re-query CCDS DB by Nucleotide ID:NM_001276398Re-query CCDS DB by Protein ID:NP_001263327Link to BLAST:NP_001263327.1

Chromosomal Locations for CCDS 70935.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 11321517 11321582 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11322299 11322400 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11324422 11324628 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11325807 11325863 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11327925 11328050 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11333207 11333366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11334316 11334401 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (804 nt):
ATGCTTCAGATACAACCAACATTTGGCTTCCAATGCAGTGCCATCCCCATCTGCCCCACTGGTAACAAGA
AT
CCGGGGTTCATTTGCATCCCTGGCACCATGCGTCTACAGCTTGGCACCAAGAACATTGGGTGGGACTG
C
TTTCCAAAGGACATCATTATCCACAAAAGAGAGAAAACTGGACATACATATGAAAAAGAAGATGACCTG
CTG
ATTGGAGTGCCTAGTGAAGCCACAGTTCTTGGAACCATCCAGCTACTATGTGCCCTGATACTTGCAA
GC
TTTGGGGGCATTTTGGTGTCAGCTTCCTACTTCAACCCAGAAGTTTCCACCACTTTGATATCTGGATA
C
CTGTTTATTGGATCCCTCTGTTTTGCCATTGCTGGAATTCTCTCCATTATCTCTGAAAAAATCTCAACC
AAA
CCCTTTGCACTGAGCAGCCTGGCCTCCAATGTAGCAAGCTCTGTTGTTGCCGTCATTGGCCTCTTCC
TC
TTCACCTATTGTCTGATAGCCCTGGGGAGTGCTTTCCCACACTGTAACTCAGAAAAGAAATTCCTGTC
C
TTATTGTCTTACTTGAAATCCCACCATTGGAAGAATGAAGACAAGAACTGTTACCTGGCTTATGTCGGT
GCT
ATGAGTGCTCTGGGGATGATGCTTCTCTTCACTGTGCTGGAGGTTTTCCTAGCTGGATACAGTTCTA
TC
TTTTGGTGGAAGCAAGTCTACTCCAACAAACCTGGGGGTACATTTTTCTTGCCTCAATCACAAGATCA
T
ACCCAACTTGTTAAAAGCAATTTGTTGCAATAA


Translation (267 aa):
MLQIQPTFGFQCSAIPICPTGNKNPGFICIPGTMRLQLGTKNIGWDCFPKDIIIHKREKTGHTYEKEDDL
L
IGVPSEATVLG
TIQLLCALILASFGGILVSASYFNPEVSTTLISGYLFIGSLCFAIAGILSIISEKIST
K
PF
ALSSLASNVASSVVAVIGLFLFTYCLIALGSAFPHCNSEKKFLSLLSYLKSHHWKNEDKNCYLAYVG
A
M
SALGMMLLFTVLEVFLAGYSSIFWWKQVYSNKPGGTFFLPQSQDHTQLVKSNLLQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser