NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS71058.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
71058.1 Public Mus musculus 2 Cd302 23 108 98 CCDS HistoryNCBI Gene:66205Re-query CCDS DB by CCDS ID:71058.1Re-query CCDS DB by GeneID:66205See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 71058.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000074606.10 ENSMUSP00000074188.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000074606.10Link to Ensembl Protein Viewer:ENSMUSP00000074188.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000074606Re-query CCDS DB by Protein ID:ENSMUSP00000074188
Original member Current member NCBI NM_001290660.1 NP_001277589.1 Accepted alive Link to Nucleotide Sequence:NM_001290660.1Link to Protein Sequence:NP_001277589.1Re-query CCDS DB by Nucleotide ID:NM_001290660Re-query CCDS DB by Protein ID:NP_001277589Link to BLAST:NP_001277589.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001277589.1 228 Q9DCG2-1 228 100% 0 0

Chromosomal Locations for CCDS 71058.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 60252292 60252491 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 60255071 60255097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 60257033 60257203 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 60257883 60257999 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 60272102 60272212 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 60284060 60284120 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (687 nt):
ATGCCCCACGCAGCGCTGTCCTCGCTCGTGCTGCTGAGCCTCGCCACTGCCATCGTCGCCGACTGTCCTT
CA
TCTACCTGGGTCCAGTTCCAAGGCAGCTGTTATGCTTTTCTTCAAGTAACCATCAATGTGGAAAACAT
A
GAGGATGTCAGAAAACAGTGCACTGACCACGGGGCAGACATGGTAAGCATACACAATGAAGAGGAAAAC
GCG
TTTATACTGGACACTTTGCAAAAGCGATGGAAGGGTCCAGATGATCTCCTGCTAGGCATGTTCTATG
AC
ACTGATGATGCAACTTTCAAGTGGTATGATCATTCAAATATGACATTCGACAAGTGGGCAGATCAAGA
T
GGTGAGGACCTAGTTGATACCTGTGGTTTTCTGTACACCAAGACAGGTGAATGGAGAAAAGGGGATTGT
GAA
ATCTCTTCTGTGGAGGGAACACTTTGCAAAGCAGCAATCCCATATGACAAGAAGTATTTATCAGATA
AC
CACATTTTAATATCGACTCTGGTGATCGCTAGCACAGTAACTCTGGCAGTTTTGGGAGCGATCATTTG
G
TTCCTCTATAGAAGAAACGCGCGCTCTGGCTTCACCTCTTTTTCACCTGCACCACTGTCACCTTACAGT
GAT
GGCTGTGCCCTGGTAGTTGCAGAAGAAGATGAATATGCTGTTCAGCTGGACTAA


Translation (228 aa):
MPHAALSSLVLLSLATAIVADCPSSTWVQFQGSCYAFLQVTINVENIEDVRKQCTDHGADMVSIHNEEEN
A
FILDTLQKRWKGPDDLLLGMFYDTD
DATFKWYDHSNMTFDKWADQDGEDLVDTCGFLYTKTGEWRKGDC
E
ISSVEGTLCKAA
IPYDKKYLSDNHILISTLVIASTVTLAVLGAIIWFLYRRNARSGFTSFSPAPLSPYS
D
GCALVVAEEDEYAVQLD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser