NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS76869.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
76869.1 Public Homo sapiens 16 MMP2 22 109 92 CCDS HistoryNCBI Gene:4313Re-query CCDS DB by CCDS ID:76869.1Re-query CCDS DB by GeneID:4313See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 18, NCBI annotation release 107, Ensembl annotation release 79

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 76869.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000543485.5 ENSP00000444143.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000543485.5Link to Ensembl Protein Viewer:ENSP00000444143.1Re-query CCDS DB by Nucleotide ID:ENST00000543485Re-query CCDS DB by Protein ID:ENSP00000444143
Original member Current member EBI,WTSI ENST00000570308.5 ENSP00000461421.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000570308.5Link to Ensembl Protein Viewer:ENSP00000461421.1Re-query CCDS DB by Nucleotide ID:ENST00000570308Re-query CCDS DB by Protein ID:ENSP00000461421
Original member Current member NCBI NM_001302508.1 NP_001289437.1 Accepted alive Link to Nucleotide Sequence:NM_001302508.1Link to Protein Sequence:NP_001289437.1Re-query CCDS DB by Nucleotide ID:NM_001302508Re-query CCDS DB by Protein ID:NP_001289437Link to BLAST:NP_001289437.1
Original member Current member NCBI NM_001302509.1 NP_001289438.1 Accepted alive Link to Nucleotide Sequence:NM_001302509.1Link to Protein Sequence:NP_001289438.1Re-query CCDS DB by Nucleotide ID:NM_001302509Re-query CCDS DB by Protein ID:NP_001289438Link to BLAST:NP_001289438.1
Original member Current member NCBI NM_001302510.1 NP_001289439.1 Accepted alive Link to Nucleotide Sequence:NM_001302510.1Link to Protein Sequence:NP_001289439.1Re-query CCDS DB by Nucleotide ID:NM_001302510Re-query CCDS DB by Protein ID:NP_001289439Link to BLAST:NP_001289439.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001289437.1 584 P08253-2 584 100% 0 0
NP_001289438.1 584 P08253-2 584 100% 0 0
NP_001289439.1 584 P08253-2 584 100% 0 0

Chromosomal Locations for CCDS 76869.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 55482984 55483135 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 55484016 55484164 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 55485299 55485427 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 55485604 55485777 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 55488543 55488716 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 55489651 55489824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 55491801 55491956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 55493158 55493293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 55496926 55497062 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 55498289 55498448 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 55502779 55502888 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 55505339 55505442 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1755 nt):
ATGCAGAAGTTCTTTGGACTGCCCCAGACAGGTGATCTTGACCAGAATACCATCGAGACCATGCGGAAGC
CA
CGCTGCGGCAACCCAGATGTGGCCAACTACAACTTCTTCCCTCGCAAGCCCAAGTGGGACAAGAACCA
G
ATCACATACAGGATCATTGGCTACACACCTGATCTGGACCCAGAGACAGTGGATGATGCCTTTGCTCGT
GCC
TTCCAAGTCTGGAGCGATGTGACCCCACTGCGGTTTTCTCGAATCCATGATGGAGAGGCAGACATCA
TG
ATCAACTTTGGCCGCTGGGAGCATGGCGATGGATACCCCTTTGACGGTAAGGACGGACTCCTGGCTCA
T
GCCTTCGCCCCAGGCACTGGTGTTGGGGGAGACTCCCATTTTGATGACGATGAGCTATGGACCTTGGGA
GAA
GGCCAAGTGGTCCGTGTGAAGTATGGGAACGCCGATGGGGAGTACTGCAAGTTCCCCTTCTTGTTCA
AT
GGCAAGGAGTACAACAGCTGCACTGATACCGGCCGCAGCGATGGCTTCCTCTGGTGCTCCACCACCTA
C
AACTTTGAGAAGGATGGCAAGTACGGCTTCTGTCCCCATGAAGCCCTGTTCACCATGGGCGGCAACGCT
GAA
GGACAGCCCTGCAAGTTTCCATTCCGCTTCCAGGGCACATCCTATGACAGCTGCACCACTGAGGGCC
GC
ACGGATGGCTACCGCTGGTGCGGCACCACTGAGGACTACGACCGCGACAAGAAGTATGGCTTCTGCCC
T
GAGACCGCCATGTCCACTGTTGGTGGGAACTCAGAAGGTGCCCCCTGTGTCTTCCCCTTCACTTTCCTG
GGC
AACAAATATGAGAGCTGCACCAGCGCCGGCCGCAGTGACGGAAAGATGTGGTGTGCGACCACAGCCA
AC
TACGATGATGACCGCAAGTGGGGCTTCTGCCCTGACCAAGGGTACAGCCTGTTCCTCGTGGCAGCCCA
C
GAGTTTGGCCACGCCATGGGGCTGGAGCACTCCCAAGACCCTGGGGCCCTGATGGCACCCATTTACACC
TAC
ACCAAGAACTTCCGTCTGTCCCAGGATGACATCAAGGGCATTCAGGAGCTCTATGGGGCCTCTCCTG
AC
ATTGACCTTGGCACCGGCCCCACCCCCACGCTGGGCCCTGTCACTCCTGAGATCTGCAAACAGGACAT
T
GTATTTGATGGCATCGCTCAGATCCGTGGTGAGATCTTCTTCTTCAAGGACCGGTTCATTTGGCGGACT
GTG
ACGCCACGTGACAAGCCCATGGGGCCCCTGCTGGTGGCCACATTCTGGCCTGAGCTCCCGGAAAAGA
TT
GATGCGGTATACGAGGCCCCACAGGAGGAGAAGGCTGTGTTCTTTGCAGGGAATGAATACTGGATCTA
C
TCAGCCAGCACCCTGGAGCGAGGGTACCCCAAGCCACTGACCAGCCTGGGACTGCCCCCTGATGTCCAG
CGA
GTGGATGCCGCCTTTAACTGGAGCAAAAACAAGAAGACATACATCTTTGCTGGAGACAAATTCTGGA
G
A
TACAATGAGGTGAAGAAGAAAATGGATCCTGGCTTCCCCAAGCTCATCGCAGATGCCTGGAATGCCAT
C
CCCGATAACCTGGATGCCGTCGTGGACCTGCAGGGCGGCGGTCACAGCTACTTCTTCAAGGGTGCCTAT
TAC
CTGAAGCTGGAGAACCAAAGTCTGAAGAGCGTGAAGTTTGGAAGCATCAAATCCGACTGGCTAGGCT
GC
TGA


Translation (584 aa):
MQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFAR
A
FQVWSDVTPLRFSRIHDGEADIMINFGRW
EHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLG
E
GQ
VVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNA
E
GQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPET
AMSTVGGNSEGAPCVFPFTFL
G
NKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQ
GYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYT
Y
TKNFRLSQDDIKGIQELY
GASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRT
V
TPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFA
GNEYWIYSASTLERGYPKPLTSLGLPPDVQ
R
VDAAFNWSKNKKTYIFAGDKFW
RYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAY
Y
LKLENQSLKSVKFGSIKSDWLGC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser