NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS79425.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
79425.1 Public Mus musculus 16 Mpv17l 23 108 98 CCDS HistoryNCBI Gene:93734Re-query CCDS DB by CCDS ID:79425.1Re-query CCDS DB by GeneID:93734See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 19, NCBI annotation release 105, Ensembl annotation release 81

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 79425.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000143697.7 ENSMUSP00000116147.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000143697.7Link to Ensembl Protein Viewer:ENSMUSP00000116147.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000143697Re-query CCDS DB by Protein ID:ENSMUSP00000116147
Original member Current member NCBI NM_001289561.1 NP_001276490.1 Accepted alive Link to Nucleotide Sequence:NM_001289561.1Link to Protein Sequence:NP_001276490.1Re-query CCDS DB by Nucleotide ID:NM_001289561Re-query CCDS DB by Protein ID:NP_001276490Link to BLAST:NP_001276490.1

Chromosomal Locations for CCDS 79425.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 13940714 13941023 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13944666 13944736 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13946529 13946587 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 13946752 13946755 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (444 nt):
ATGGCGAGCTGGTGGCGCGCGTTTCCACAGGCAGCACGGCGCTATCCGTGGCCCACTAACGTGCTGCTCT
AC
GCCGGGCTCTTCTCGGCGGGTGATGCCCTGCAGCAGCGACTGCGGGGAGGCCCAGCCGACTGGCGCCA
G
ACGCGTCGCGTGGCCACTCTGGCCGTGACCTTCCACGGAAACTTCAACTACGTGTGGCTGCGCCTACTG
GAG
CGCGCCCTGCCAGGCCGCGCGCCGCGCACGGTCCTGGCCAAGGTGCTATGCGATCAGACTGTCGGAG
GG
CCGATAGCCCTCTCTGCCTTCTACGTCGGCATGAGCGTTCTCCAGGGGAAGGATGACATATTTTTGGA
C
CTGAAGCAGAAATTCTGGAATACGTATAAGCATTCTAACCAGGCTTTCCTTCATTCCAGAGTGGTCTCA
TGT
ACTGGCCCTTTGTGCAGCTGA


Translation (147 aa):
MASWWRAFPQAARRYPWPTNVLLYAGLFSAGDALQQRLRGGPADWRQTRRVATLAVTFHGNFNYVWLRLL
E
RALPGRAPRTVLAKVLCDQTVGGPIALSAFYV
GMSVLQGKDDIFLDLKQKFWNTYKHSNQAFLHSRVVS
C
TGPLC
S



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser