NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS80324.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
80324.1 Public Mus musculus 5 Rufy3 23 108 98 CCDS HistoryNCBI Gene:52822Re-query CCDS DB by CCDS ID:80324.1Re-query CCDS DB by GeneID:52822See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 19, NCBI annotation release 105, Ensembl annotation release 81

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 80324.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000198965.4 ENSMUSP00000143302.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000198965.4Link to Ensembl Protein Viewer:ENSMUSP00000143302.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000198965Re-query CCDS DB by Protein ID:ENSMUSP00000143302
Original member Current member NCBI NM_001289774.1 NP_001276703.1 Accepted alive Link to Nucleotide Sequence:NM_001289774.1Link to Protein Sequence:NP_001276703.1Re-query CCDS DB by Nucleotide ID:NM_001289774Re-query CCDS DB by Protein ID:NP_001276703Link to BLAST:NP_001276703.1

Chromosomal Locations for CCDS 80324.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 88565149 88565476 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88614941 88615114 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88616462 88616579 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88617335 88617436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88621301 88621424 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88627221 88627282 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88628025 88628090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88630537 88630606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88632439 88632531 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88635192 88635275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88637192 88637359 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88638981 88639078 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88642929 88643048 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88644068 88644164 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88645537 88645601 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88647219 88647246 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88648256 88648324 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 88649832 88649975 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2010 nt):
ATGGCAGAGTCGCCGGCGCCCGGCGCGGCTGCTGAAAGTTGCGGCGAAGAGCAGGAGAGGGGCGGGGAGC
GG
CGCCCCTCCGAGCCGCTGGAACCGCGCGGTGCTAGCGCCCGCGGCGCGGACCGGGAGGACGAGGCGGG
G
CCCTCGGAGCCGGACTCGCCGGTGGCCGCCCCCTTCTTCCTCCTCTACCCGGGCGATGGAGGCGCGGGC
TTC
ACAGCGCGCCCGCCACCGCAGCGCGCCTGGAGGACCCCGCCGTCGCCCGGCTCCCCGCTGCCCTTCC
TG
CTGCTGAGCTACCCGAGCGGCGGCAGCGGCGGCGGAGGCAAGCACCATCCCAATTATCTCATGGCTAA
C
GAACGCATGAACCTGATGAACATGGCAAAGCTGAGCATCAAGGGCTTGATTGAATCGGCTCTGAATCTG
GGG
CGGACCCTGGACTCTGACTACGCACCTCTCCAGCAGTTTTTCGTGGTGATGGAACACTGCCTGAAAC
AC
GGCTTGAAAGCCAAGAAAACTTTTCTTGGACAAAATAAATCCTTCTGGGGGCCTCTAGAGCTGGTGGA
G
AAGCTTGTTCCAGAAGCTGCAGAAATAACAGCGAGTGTAAAAGACCTCCCAGGACTCAAGACACCAGTT
GGC
AGAGGAAGAGCCTGGCTTCGGTTGGCATTGATGCAAAAGAAGCTTTCTGAGTATATGAAAGCCTTGA
TC
AATAAGAAGGAACTTCTCAGTGAGTTCTATGAAGTCAATGCCCTCATGATGGAAGAAGAAGGAGCTAT
T
ATCGCTGGTCTCCTGGTGGGTCTGAATGTCATCGATGCCAATTTCTGCATGAAAGGAGAAGACCTGGAC
TCT
CAGGTTGGAGTTATAGATTTTTCGATGTATCTCAAAGATGGAAACAGTAGTAAAGGTAGTGAAGGGG
AT
GGACAGATTACTGCGATCCTAGACCAGAAGAACTATGTAGAAGAACTCAACAGACATCTGAATGCAAC
T
GTAAACAACCTTCAGACAAAAGTAGATCTGTTAGAAAAATCCAACACTAAATTGACAGAAGAACTTGCC
GTT
GCCAACAACAGAATTATTACCTTACAAGAAGAAATGGAACGAGTTAAAGAAGAAAGCTCCTATCTAC
TG
GAATCCAATCGGAAGGGTCCTAAACAAGACAGAACTGCAGAAGGGCAAGCGCTGAGCGAAGCCAGAAA
G
CATCTAAAGGAGGAGACACAGTTAAGATTGGATGTCGAGAAGGAGCTGGAGCTGCAGATCAGCATGAGG
CAG
GAGATGGAACTGGCTATGAAGATGCTGGAGAAGGATGTCTGTGAGAAGCAGGATGCCCTGGTGTCTC
TG
CGGCAGCAGCTGGACGATCTCCGGGCTCTTAAGCATGAGCTCGCCTTTAAACTGCAGAGTTCAGACCT
A
GGAGTGAAACAGAAAAGTGAATTAAACAGTCGCTTGGAAGAAAAGACCAATCAGATGGCTGCCACCATT
AAA
CAGCTGGAGCAAAGATTGCGCCAGGCTGAGCGAGGCCGCCAGTCTGCTGAGCTGGACAACCGGCTCT
TC
AAACAGGACTTTGGAGACAAGATCAACAGTCTGCAGCTGGAAGTGGAGGCGCTCACCAGGCAGCGGAC
T
CAGCTGGAGTTAGAACTGAAACAAGAAAAGGAGAGGAAGTCACAAAACAGGGGCACCCCAGGGAAGGGG
GCC
CAGAAGCCAGAGCTGCGCATGGATGGGAAGCACAGAATCCAAGAGGAAAACGTTAAACTAAAGAAGC
CG
CTGGAAGAAAGCCACAGGCTTCTGACTCACCCTGCAGAGGAACAGGGTCAGCCTTCGCTCTCTGAAAA
G
CCACAGGTGTGTCAGCTGTGCCAGGAAGACGACAGCCTGACAAAGAACACGTGTAGAAACTGCAGAGGA
ACC
TTCTGTAACGCCTGCACAACAAATGAACTGCCTCTTCCGTCAAGCATCAAGCCTGAGCGAGTGTGCA
AT
CCTTGTCACGAGCAGCTGATAAAGCAGTACTCCAGCAGCCCACCCTAA


Translation (669 aa):
MAESPAPGAAAESCGEEQERGGERRPSEPLEPRGASARGADREDEAGPSEPDSPVAAPFFLLYPGDGGAG
F
TARPPPQRAWRTPPSPGSPLPFLLLSYPSGGSGGGGKH
HPNYLMANERMNLMNMAKLSIKGLIESALNL
G
RTLDSDYAPLQQFFVVMEHCLKHGLK
AKKTFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPV
G
RGRAWLRLALMQKKLSEYMKALINKKELL
SEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLD
S
Q
VGVIDFSMYLKDGNSSKGSEGDGQITAILDQKNYVEELNRHLNATVNNLQTKVDLLEKSNTKLTEELA
V
ANNRIITLQEEMERVKEESSYLLESNRK
GPKQDRTAEGQALSEARKHLKEETQLRLDVEKELELQISMR
Q
EMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQ
SSDLGVKQKSELNSRLEEKTNQMAATI
K
QLEQ
RLRQAERGRQSAELDNRLFKQDFGDKINSLQLEVEALTRQRTQLELELKQEKERKSQNRGTPGKG
A
QKPELRM
DGKHRIQEENVKLKKPLEESHRLLTHPAEEQGQPSLSEKPQVCQLCQEDDSLTKNTCRNCRG
T
FCNACTTNELPLPSSIKPERVCNPCHEQLIKQYSSSPP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser