NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS84150.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
84150.1 Public Mus musculus 14 Hmbox1 23 108 98 CCDS HistoryNCBI Gene:219150Re-query CCDS DB by CCDS ID:84150.1Re-query CCDS DB by GeneID:219150See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 21, NCBI annotation release 106, Ensembl annotation release 86

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 84150.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000176128.7 ENSMUSP00000135448.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000176128.7Link to Ensembl Protein Viewer:ENSMUSP00000135448.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000176128Re-query CCDS DB by Protein ID:ENSMUSP00000135448
Original member Current member NCBI NM_001347626.1 NP_001334555.1 Accepted alive Link to Nucleotide Sequence:NM_001347626.1Link to Protein Sequence:NP_001334555.1Re-query CCDS DB by Nucleotide ID:NM_001347626Re-query CCDS DB by Protein ID:NP_001334555Link to BLAST:NP_001334555.1

Chromosomal Locations for CCDS 84150.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 64823561 64823698 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64825601 64825695 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64826772 64826867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64828586 64828668 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64851885 64852038 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64861516 64861626 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64887575 64887660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64896650 64897126 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64903239 64903261 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1263 nt):
ATGCTCAGCTCCTTTCCAGTGGTTTTGCTGGAAACCATGTCTCACTACACAGATGAACCCAGATTTACCA
TA
GAACAGATAGACCTGCTCCAGCGTCTTCGGCGTACCGGGATGACCAAACATGAAATCCTTCATGCATT
A
GAAACTTTGGACCGTCTTGATCAAGAGCATAGTGATAAATTTGGAAGGAGGTCCAGCTACGGGGGAAGC
TCA
TATGGGAACAGTACCAACAACGTTCCAGCATCTTCCTCTACAGCCACAGCTTCCACGCAGACCCAGC
AC
TCGGGAATGTCCCCATCACCCAGCAACAGTTACGATACCTCCCCACTGCCTTGCACTACCAATCAAAA
T
GGGAGGGAGAACAATGATCGATTGTCCACATCCAATGGGAAGATGTCACCATCTCGCTACCATGCAAAC
AGC
ATGGGTCAGAGGTCATATAGCTTTGAGGCCTCAGAAGAGGACCTAGATGTAGATGATAAAGTGGAGG
AA
TTAATGAGGAGGGACAGCAGTGTGATAAAAGAGGAAATCAAAGCCTTTCTTGCCAATCGGAGGATTTC
C
CAAGCAGTTGTTGCACAGGTAACAGGAATCAGTCAGAGTCGAATCTCTCACTGGCTGCTGCAGCAGGGA
TCA
GATCTGAGTGAGCAGAAGAAAAGGGCGTTCTACCGATGGTATCAACTTGAGAAGACAAACCCTGGGG
CT
ACGCTAAGTATGAGACCTGCCCCCATTCCAATAGAGGACCCTGAATGGAGACAAACACCTCCCCCAGT
C
TCCGCCACACCTGGAACCTTCCGGCTTCGACGAGGGAGTAGATTTACCTGGAGAAAGGAGTGCCTAGCT
GTC
ATGGAAAGTTACTTCAATGAGAACCAGTACCCAGATGAAGCAAAGAGAGAAGAAATTGCCAATGCTT
GC
AATGCAGTCATACAGAAGCCAGGCAAAAAGCTGTCTGACCTGGAACGAGTTACCTCTCTGAAAGTATA
T
AATTGGTTTGCTAATCGACGGAAGGAGATCAAGAGAAGAGCCAATATCGAAGCAGCAATCCTGGAGAGT
CAT
GGGATAGATGTACAGAGTCCAGGAGGCCATTCCAACAGTGACGATGTGGACGGGAACGACTACTCCG
AG
CAGGATGACAGCACCAGCCATAGTGACCACCAAGATCCCATCTCGCTAGCTGTGGAGATGGCGGCCGT
C
AACCACACTATCTTGGCATTGGCCCGGCAGGGAGCCAATGAAATCAAGACAGAGGCCCTGGATGATGAC
TGA


Translation (420 aa):
MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDKFGRRSSYGGS
S
YGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPLPCTTNQNGRENNDRLSTSNGKMSPSRYHAN
S
MGQRSYSFEASEEDLDVDDKVEELM
RRDSSVIKEEIKAFLANRRISQAVVAQVTGISQSRISHWLLQQG
S
DLSEQKKRAFYRWYQLEKTNP
GATLSMRPAPIPIEDPEWRQTPPPVSATPGTFRLRRGSRFTWRKECLA
V
ME
SYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIEAAILES
H
GIDVQSPGGHSNSDDVDGNDYSEQ
DDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser