NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS85161.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
85161.1 Public Mus musculus 6 Rad51ap1 23 108 98 CCDS HistoryNCBI Gene:19362Re-query CCDS DB by CCDS ID:85161.1Re-query CCDS DB by GeneID:19362See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 21, NCBI annotation release 106, Ensembl annotation release 86

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 85161.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000112220.7 ENSMUSP00000107839.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112220.7Link to Ensembl Protein Viewer:ENSMUSP00000107839.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000112220Re-query CCDS DB by Protein ID:ENSMUSP00000107839
Original member Current member NCBI NM_001347455.1 NP_001334384.1 Accepted alive Link to Nucleotide Sequence:NM_001347455.1Link to Protein Sequence:NP_001334384.1Re-query CCDS DB by Nucleotide ID:NM_001347455Re-query CCDS DB by Protein ID:NP_001334384Link to BLAST:NP_001334384.1

Chromosomal Locations for CCDS 85161.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 126924195 126924340 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 126924918 126925067 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 126926359 126926517 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 126927538 126927687 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 126928141 126928227 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 126929993 126930102 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 126934714 126934849 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 126935953 126936008 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 126939494 126939510 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1011 nt):
ATGGTGCGTCCTATCAGAAATAGAAAACCAATAAATTATTCACAGTTTGAAGATTCTGGCAATGACTCTG
AT
GATGATTTTATTTCTTCATCCACACCTGTAAACAAGTCAAAAACTGTGCCAAAGGTATTAAAGCAAGA
C
AAACCAAAACCTAACTTGAAGAATCTCCAAAAAGAAGAGGTCTTACCAACAGAACCCCCTAAAAAAAGG
GTG
GCTTTAGATGACAAGGTCTTCCAAAGAGGTCTAGAAGTTGCCCTGGCTTTATCTGTGAAGGAACTTC
CA
ACACTCACCAACCAAGTAAAGAAGTCCAAAGAGAAAAGCACTGACAAACAAGGCAAAGAGAAAACAGA
A
AATACGGGTAAACCTCCTCATGTCTCTAACTGCAGTGTAGCCAGTGATGATGTAGATTTGGACAAGATC
ACA
GAGGAGGGGGACGCCTCGAGTGTTGAAGGGGAGAGGAAGTCACCATCTCAAGCCAAGGCTCCGCGGA
GG
AGAGCACCTTCTGAAGGCAGCGATGGCAGCAGTGCTAACGACACGGAGTCGGAGAGCGCCACTGGTGA
A
GGTTCAGAAAGTGATCCTGATTTTGATGAGAGTAAAGAAAGTGATGAAGACTTTGGTGTGAGAAGAAGT
AAA
GAATCAAAGAAGAAAACAGTGCAGAAGAAACCTGCAGGGGAAAAGAAGGAAAGGAAATCAAAACCCA
AA
TGTGAGGCATCAGTGACTTCAGTAGACCCAGCTCCAGCTGCCATCAAGTCAGGATCTCCATCTTTACC
C
CAGGCAGTTGGTCTTCCTTCTGAGGCCACTAGGAAACCAGCAATAATGTGCAGCCCTTCAGCTGAAAGC
AAG
AGGCCCAAGTGGGTCCCCCCAGCTGCCTCTGGGAGCAGGAACTCTAGCAGCAATGCATTGGCAGGAA
CA
CCTGCCAAGTCCCCGAGTCAGAGCCTGCGTCTGGGCCTCTCCCGATTAGCGCCAGTTAAGCGCTTGCA
T
CCAAGTGCCACAAGCAGCCAAGTGCGGTAG


Translation (336 aa):
MVRPIRNRKPINYSQFEDSGNDSDDDFISSSTPVNKSKTVPKVLKQDKPKPNLKNLQKEEVLPTEPPKKR
V
ALDDKVFQRGLEVALALSVKELPTLTNQVKKSKEK
STDKQGKEKTENTGKPPHVSNCSVASDDVDLDKI
T
EEGDASSVEGERKSPSQAKAPRRRAPSEGSDGSSANDTESESAT
GEGSESDPDFDESKESDEDFGVRRS
K
ESKKKTVQKKPAGEKKERKSKPKCEAS
VTSVDPAPAAIKSGSPSLPQAVGLPSEATRKPAIMCSPSAES
K
RPKWVPP
AASGSRNSSSNALAGTPAKSPSQSLRLGLSRLAPVKRLHPSATSSQVR



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser