NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS8529.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8529.1 Public Homo sapiens 12 RAD51AP1 22 109 92 CCDS HistoryNCBI Gene:10635Re-query CCDS DB by CCDS ID:8529.1Re-query CCDS DB by GeneID:10635See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8529.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000352618.8 ENSP00000309479.7 Accepted alive Link to Ensembl Transcript Viewer:ENST00000352618.8Link to Ensembl Protein Viewer:ENSP00000309479.7Re-query CCDS DB by Nucleotide ID:ENST00000352618Re-query CCDS DB by Protein ID:ENSP00000309479
Original member NCBI NM_006479.4 NP_006470.1 Updated not alive Link to Nucleotide Sequence:NM_006479.4Link to Protein Sequence:NP_006470.1Re-query CCDS DB by Nucleotide ID:NM_006479Re-query CCDS DB by Protein ID:NP_006470
Current member NCBI NM_006479.5 NP_006470.1 Accepted alive Link to Nucleotide Sequence:NM_006479.5Link to Protein Sequence:NP_006470.1Re-query CCDS DB by Nucleotide ID:NM_006479Re-query CCDS DB by Protein ID:NP_006470Link to BLAST:NP_006470.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006470.1 335 Q96B01-2 335 100% 0 0

Chromosomal Locations for CCDS 8529.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 4538940 4538956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 4541884 4541933 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 4543763 4543904 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 4546309 4546418 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 4548092 4548178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 4548687 4548836 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 4552983 4553147 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 4556353 4556502 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 4558857 4558993 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1008 nt):
ATGGTGCGGCCTGTGAGACATAAGAAACCAGTCAATTACTCACAGTTTGACCACTCTGACAGTGATGATG
AT
TTTGTTTCTGCAACTGTACCTTTAAACAAGAAATCCAGAACAGCACCAAAGGAGTTAAAACAAGATAA
A
CCAAAACCTAACTTGAACAATCTCCGGAAAGAAGAAATCCCAGTACAAGAGAAAACCCCTAAAAAAAGG
ATG
GCTTTAGATGACAAGCTCTACCAGAGAGACTTAGAAGTTGCACTAGCTTTATCAGTGAAGGAACTTC
CA
ACAGTCACCACTAATGTGCAGAACTCTCAAGATAAAAGCATTGAAAAACATGGCAGTAGTAAAATAGA
A
ACAATGAATAAGTCTCCTCATATCTCTAATTGCAGTGTAGCCAGTGATTATTTAGATTTGGATAAGATT
ACT
GTGGAAGATGATGTTGGTGGTGTTCAAGGGAAAAGAAAAGCAGCATCTAAAGCTGCAGCACAGCAGA
GG
AAGATTCTTCTGGAAGGCAGTGATGGTGATAGTGCTAATGACACTGAACCAGACTTTGCACCTGGTGA
A
GATTCTGAGGATGATTCTGATTTTTGTGAGAGTGAGGATAATGACGAAGACTTCTCTATGAGAAAAAGT
AAA
GTTAAAGAAATTAAAAAGAAAGAAGTGAAGGTAAAATCCCCAGTAGAAAAGAAAGAGAAGAAATCTA
AA
TCCAAATGTAATGCTTTGGTGACTTCGGTGGACTCTGCTCCAGCTGCCGTCAAATCAGAATCTCAGTC
C
TTGCCAAAAAAGGTTTCTCTGTCTTCAGATACCACTAGGAAACCATTAGAAATACGCAGTCCTTCAGCT
GAA
AGCAAGAAACCTAAATGGGTCCCACCAGCGGCATCTGGAGGTAGCAGAAGTAGCAGCAGCCCACTGG
TG
GTAGTGTCTGTGAAGTCTCCCAATCAGAGTCTCCGCCTTGGCTTGTCCAGATTAGCACGAGTTAAACC
T
TTGCATCCAAATGCCACTAGCACCTGA


Translation (335 aa):
MVRPVRHKKPVNYSQFDHSDSDDDFVSATVPLNKKSRTAPKELKQDKPKPNLNNLRKEEIPVQEKTPKKR
M
ALDDKLYQRDLEVALALSVKELPTVTTNVQNSQDK
SIEKHGSSKIETMNKSPHISNCSVASDYLDLDKI
T
VEDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAP
GEDSEDDSDFCESEDNDEDFSMRKS
K
VKEIKKKEVKVKSPVEKKEKKSKSKCNAL
VTSVDSAPAAVKSESQSLPKKVSLSSDTTRKPLEIRSPSA
E
SKKPKWVPP
AASGGSRSSSSPLVVVSVKSPNQSLRLGLSRLARVKPLHPNATST



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser