NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS87661.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
87661.1 Public Homo sapiens 9 PTCH1 22 109 92 CCDS HistoryNCBI Gene:5727Re-query CCDS DB by CCDS ID:87661.1Re-query CCDS DB by GeneID:5727See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 22, NCBI annotation release 109, Ensembl annotation release 92

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 87661.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000468211.6 ENSP00000449745.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000468211.6Link to Ensembl Protein Viewer:ENSP00000449745.1Re-query CCDS DB by Nucleotide ID:ENST00000468211Re-query CCDS DB by Protein ID:ENSP00000449745
Original member NCBI NM_001354919.1 NP_001341848.1 Updated not alive Link to Nucleotide Sequence:NM_001354919.1Link to Protein Sequence:NP_001341848.1Re-query CCDS DB by Nucleotide ID:NM_001354919Re-query CCDS DB by Protein ID:NP_001341848
Current member NCBI NM_001354919.2 NP_001341848.1 Accepted alive Link to Nucleotide Sequence:NM_001354919.2Link to Protein Sequence:NP_001341848.1Re-query CCDS DB by Nucleotide ID:NM_001354919Re-query CCDS DB by Protein ID:NP_001341848Link to BLAST:NP_001341848.1

Chromosomal Locations for CCDS 87661.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 95481945 95482040 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95482134 95482203 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95485685 95485874 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95506407 95506599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95516469 95516471 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (552 nt):
ATGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGAGCGAAGTTTCAGAGACTCTTATTTAAAC
TG
GGTTGTTACATTCAAAAAAACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGGGCCTTCGC
G
GTGGGATTAAAAGCAGCGAACCTCGAGACCAACGTGGAGGAGCTGTGGGTGGAAGTTGGAGGACGAGTA
AGT
CGTGAATTAAATTATACTCGCCAGAAGATTGGAGAAGAGGCTATGTTTAATCCTCAACTCATGATAC
AG
ACCCCTAAAGAAGAAGGTGCTAATGTCCTGACCACAGAAGCGCTCCTACAACACCTGGACTCGGCACT
C
CAGGCCAGCCGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAACATTTGTGTTACAAATCA
GGA
GAGCTTATCACAGAAACAGGTTACATGGATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTA
CA
CCTTTGGACTGCTTCTGGGAAGGGGCGAAATTACAGTCTGGGACAGCATACCTCCTGTAA


Translation (183 aa):
MGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRV
S
RELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYN
RQWKLEHLCYKS
G
ELITETGYMDQ
IIEYLYPCLIITPLDCFWEGAKLQSGTAYLL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser