NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS88485.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
88485.1 Public Mus musculus 13 Zfp825 23 108 98 CCDS HistoryNCBI Gene:235956Re-query CCDS DB by CCDS ID:88485.1Re-query CCDS DB by GeneID:235956See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 23, NCBI annotation release 108, Ensembl annotation release 98

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 88485.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000221173.1 ENSMUSP00000152719.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000221173.1Link to Ensembl Protein Viewer:ENSMUSP00000152719.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000221173Re-query CCDS DB by Protein ID:ENSMUSP00000152719
Current member NCBI NM_001374752.1 NP_001361681.1 Accepted alive Link to Nucleotide Sequence:NM_001374752.1Link to Protein Sequence:NP_001361681.1Re-query CCDS DB by Nucleotide ID:NM_001374752Re-query CCDS DB by Protein ID:NP_001361681Link to BLAST:NP_001361681.1

Chromosomal Locations for CCDS 88485.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 74480517 74481150 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74482539 74482599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74482817 74482943 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74483899 74483955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (879 nt):
ATGGCAAGTGTTCATGACATCAATACTACCCAAGGCTTCAGAGTCATTGGATTGCAGGATGCAGTGACTT
AT
GATGATGTGCGTGTGAACTTCACTGAGGAAGAGTGGGATTTGCTGGATCCTTCCCAGAAAAGTCTCTA
T
GAAGAGGTGATGCTGGAGACCTACCAGAACATCACTGCTATAGGCTACAAGTGGGAAGACCATCATATT
GAA
GAATATTGTCAAAGTTCTAGAAGACATGAAAGGCATGAAAGAATTCATATTGGAGAGAAACCCTATG
AA
CGTAACCAATGTGGTAAAGCCTTTGCAAGTGACAATCATCTCCAAATACATAAAAGAACAAATACTGA
A
GAGAAACCTTATGAATGTAATCAATGTGGTAAAGCCTTTTCACAACACAGTAGACTCCAATATCATAAA
AGA
AGTCATACTGGAGAGAAACCCTATAAATGTAATCAGTGTGGTAAAGCCTATGGACATCACAGTAGTC
TC
CAGTATCATAAAAGAAGACATACTGGAGAGAAACCTTATCACTGTAATCAATGTGATAAAGCATTTTC
A
GAACACAGTAGTCTTGAATATCATAAAATAACACATCTTGGAGAGAAACCTTATGAGTGTGATCAATGT
GGT
AAAGCCTTTGCATGGCAGTCTAGTCTCAATATACATAAAAGAACACATTCTGGAGAGAAACCTTATG
AG
TGTAATGAATGTGGTAAAGCCTTTACACATCATGCTAGTCTCCAAAGTCATAAAAGAATACATACTGG
A
GAGAAACCGTATCAGTGTGATCAGTGTGGTAAAGCATTTGCACATCAAACGAGTCTCCAATGCCATAAA
AGA
ACACATACTGGAGAGAAACCTTATGAATGCAATTAA


Translation (292 aa):
MASVHDINTTQGFRVIGLQDAVTYDDVRVNFTEEEWDLLDPSQKSLYEEVMLETYQNITAIGYKWEDHHI
E
EYCQSSRRHE
RHERIHIGEKPYERNQCGKAFASDNHLQIHKRTNTEEKPYECNQCGKAFSQHSRLQYHK
R
SHTGEKPYKCNQCGKAYGHHSSLQYHKRRHTGEKPYHCNQCDKAFSEHSSLEYHKITHLGEKPYECDQC
G
KAFAWQSSLNIHKRTHSGEKPYECNECGKAFTHHASLQSHKRIHTGEKPYQCDQCGKAFAHQTSLQCHK
R
THTGEKPYECN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser