NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS9168.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9168.1 Public Homo sapiens 12 PLBD2 22 109 92 CCDS HistoryNCBI Gene:196463Re-query CCDS DB by CCDS ID:9168.1Re-query CCDS DB by GeneID:196463See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9168.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000280800.4 ENSP00000280800.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000280800.4Link to Ensembl Protein Viewer:ENSP00000280800.3Re-query CCDS DB by Nucleotide ID:ENST00000280800Re-query CCDS DB by Protein ID:ENSP00000280800
Original member NCBI NM_173542.3 NP_775813.2 Updated not alive Link to Nucleotide Sequence:NM_173542.3Link to Protein Sequence:NP_775813.2Re-query CCDS DB by Nucleotide ID:NM_173542Re-query CCDS DB by Protein ID:NP_775813
Current member NCBI NM_173542.4 NP_775813.2 Accepted alive Link to Nucleotide Sequence:NM_173542.4Link to Protein Sequence:NP_775813.2Re-query CCDS DB by Nucleotide ID:NM_173542Re-query CCDS DB by Protein ID:NP_775813Link to BLAST:NP_775813.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_775813.2 589 Q8NHP8-1 589 100% 0 0

Chromosomal Locations for CCDS 9168.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 113358601 113358890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113369116 113369209 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113372649 113372807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113374474 113374574 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113374793 113375007 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113380745 113380842 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113384105 113384265 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113384851 113384946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113385212 113385283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113386937 113387089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113387744 113387906 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113388459 113388626 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1770 nt):
ATGGTGGGCCAGATGTACTGCTACCCCGGCAGCCACCTGGCCCGGGCGCTGACGCGGGCGCTGGCGCTGG
CC
CTGGTGCTGGCCCTGCTGGTCGGGCCGTTCCTGAGCGGCCTGGCGGGGGCGATCCCAGCGCCGGGGGG
C
CGCTGGGCGCGCGATGGGCAGGTCCCTCCAGCCTCCCGCAGCCGCTCGGTGCTCCTGGACGTCTCGGCG
GGC
CAGCTGCTTATGGTGGACGGACGCCACCCTGACGCCGTGGCCTGGGCCAACCTCACCAACGCCATCC
GC
GAGACTGGGTGGGCCTTCCTGGAGCTGGGCACAAGTGGCCAATACAATGACAGCTTGCAGGCCTATGC
A
GCCGGTGTGGTGGAGGCTGCTGTGTCGGAGGAGCTCATCTACATGCACTGGATGAACACGGTGGTGAAT
TAC
TGCGGCCCCTTCGAGTATGAAGTCGGCTACTGCGAGAGGCTGAAGAGCTTCCTGGAGGCCAACCTAG
AG
TGGATGCAGGAAGAGATGGAGTCAAACCCAGACTCACCTTACTGGCACCAGGTGCGGCTGACCCTCCT
G
CAGCTGAAAGGCCTGGAGGACAGCTACGAAGGCCGTGTGAGCTTCCCAGCTGGGAAGTTCACCATCAAA
CCC
TTGGGGTTCCTCCTGCTGCAGCTCTCTGGGGACCTGGAAGACCTGGAGCTGGCCCTGAACAAGACCA
AG
ATCAAACCTTCTCTGGGCTCTGGCTCCTGTTCTGCCCTCATCAAGCTGCTCCCTGGCCAGAGTGACCT
C
CTGGTTGCCCACAACACCTGGAACAACTACCAGCACATGCTGCGTGTCATCAAGAAGTACTGGCTCCAG
TTC
CGGGAAGGCCCCTGGGGGGACTACCCGCTGGTTCCCGGCAACAAGCTGGTCTTCTCCTCCTACCCCG
GC
ACCATCTTCTCCTGCGACGACTTCTACATCCTGGGCAGTGGGCTGGTGACACTGGAGACCACCATTGG
C
AACAAGAACCCAGCCCTGTGGAAGTATGTGCGGCCCAGGGGCTGTGTGCTGGAGTGGGTACGCAACATC
GTG
GCCAACCGCCTGGCCTCGGATGGGGCCACCTGGGCAGACATCTTCAAGAGGTTCAACAGCGGCACGT
AT
AACAACCAGTGGATGATCGTGGACTACAAGGCGTTCATCCCGGGTGGGCCCAGCCCCGGGAGCCGGGT
G
CTTACCATCCTGGAGCAGATCCCCGGCATGGTGGTGGTGGCTGACAAGACCTCGGAGCTCTACCAGAAG
ACC
TACTGGGCCAGCTACAACATACCGTCCTTCGAGACTGTGTTCAATGCCAGTGGGCTGCAGGCCCTAG
TG
GCCCAGTATGGGGACTGGTTTTCTTATGACGGGAGCCCCCGGGCCCAGATCTTCCGGCGGAACCAGTC
A
CTGGTACAAGACATGGACTCCATGGTCAGGCTGATGAGGTACAATGACTTCCTCCATGACCCTCTGTCA
CTG
TGCAAAGCCTGCAACCCCCAGCCCAATGGGGAGAATGCTATCTCCGCCCGCTCCGACCTCAACCCGG
CC
AATGGCTCCTACCCCTTCCAGGCCCTGCGTCAGCGCTCCCATGGGGGTATCGATGTGAAGGTGACCAG
C
ATGTCACTGGCCAGGATCCTGAGCCTGCTGGCGGCCAGCGGTCCCACGTGGGACCAGGTGCCCCCGTTC
CAG
TGGAGCACCTCGCCCTTCAGCGGCCTGCTGCACATGGGCCAGCCAGACCTCTGGAAGTTCGCGCCTG
TC
AAGGTTTCATGGGACTGA


Translation (589 aa):
MVGQMYCYPGSHLARALTRALALALVLALLVGPFLSGLAGAIPAPGGRWARDGQVPPASRSRSVLLDVSA
G
QLLMVDGRHPDAVAWANLTNAIRET
GWAFLELGTSGQYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVN
Y
CGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQ
VRLTLLQLKGLEDSYEGRVSFPAGKFTIK
P
LGF
LLLQLSGDLEDLELALNKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQ
F
REGPW
GDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGCVLEWVRNI
V
ANRLASDGATWADIFKRFNSG
TYNNQWMIVDYKAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQK
T
YWASYNI
PSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLS
L
CKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVK
VTSMSLARILSLLAASGPTWDQVPPF
Q
WSTSPFSGLLHMGQPDLWKFAPVKVSWD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser