NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, September 21, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS9169.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9169.1 Public Homo sapiens 12 SDS 22 109 92 CCDS HistoryNCBI Gene:10993Re-query CCDS DB by CCDS ID:9169.1Re-query CCDS DB by GeneID:10993See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9169.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000257549.8 ENSP00000257549.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000257549.8Link to Ensembl Protein Viewer:ENSP00000257549.4Re-query CCDS DB by Nucleotide ID:ENST00000257549Re-query CCDS DB by Protein ID:ENSP00000257549
Original member NCBI NM_006843.2 NP_006834.2 Updated not alive Link to Nucleotide Sequence:NM_006843.2Link to Protein Sequence:NP_006834.2Re-query CCDS DB by Nucleotide ID:NM_006843Re-query CCDS DB by Protein ID:NP_006834
Current member NCBI NM_006843.3 NP_006834.2 Accepted alive Link to Nucleotide Sequence:NM_006843.3Link to Protein Sequence:NP_006834.2Re-query CCDS DB by Nucleotide ID:NM_006843Re-query CCDS DB by Protein ID:NP_006834Link to BLAST:NP_006834.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006834.2 328 P20132 328 100% 0 0

Chromosomal Locations for CCDS 9169.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 113392941 113393149 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113393892 113394016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113397165 113397392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113398515 113398606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113398707 113398846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113399112 113399151 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113399556 113399708 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (987 nt):
ATGATGTCTGGAGAACCCCTGCACGTGAAGACCCCCATCCGTGACAGCATGGCCCTGTCCAAAATGGCCG
GC
ACCAGCGTCTACCTCAAGATGGACAGTGCCCAGCCCTCCGGCTCCTTCAAGATCCGGGGCATTGGGCA
C
TTCTGCAAGAGGTGGGCCAAGCAAGGCTGTGCACATTTTGTCTGCTCCTCGGCGGGCAACGCAGGCATG
GCG
GCTGCATATGCGGCCAGGCAACTCGGCGTCCCCGCCACCATCGTGGTGCCCAGCACCACACCTGCTC
TC
ACCATTGAGCGCCTCAAGAATGAAGGTGCCACAGTCAAGGTGGTGGGTGAGTTATTGGATGAAGCCTT
C
GAGCTGGCCAAGGCCCTAGCGAAGAACAACCCGGGTTGGGTCTACATTCCCCCCTTTGATGACCCCCTC
ATC
TGGGAAGGCCACGCTTCCATCGTGAAAGAGCTGAAGGAGACACTGTGGGAAAAGCCGGGGGCCATCG
CG
CTGTCAGTGGGCGGCGGGGGCCTGCTGTGTGGAGTGGTCCAGGGGCTGCAGGAGGTGGGCTGGGGGGA
C
GTGCCTGTCATCGCCATGGAGACTTTTGGTGCCCACAGCTTCCACGCTGCCACCACCGCAGGCAAACTT
GTC
TCCCTGCCCAAGATCACCAGTGTTGCCAAGGCCCTGGGCGTGAAGACTGTGGGGGCTCAGGCCCTGA
AG
CTGTTTCAGGAACACCCCATTTTCTCTGAAGTTATCTCGGACCAGGAGGCTGTGGCCGCCATTGAGAA
G
TTCGTGGATGATGAGAAGATCCTGGTGGAGCCCGCCTGCGGGGCAGCCCTGGCCGCTGTCTATAGCCAC
GTG
ATCCAGAAGCTCCAACTGGAGGGGAATCTCCGAACCCCGCTGCCATCCCTCGTGGTCATCGTCTGCG
GG
GGCAGCAACATCAGCCTGGCCCAGCTGCGGGCGCTCAAGGAACAGCTGGGCATGACAAATAGGTTGCC
C
AAGTGA


Translation (328 aa):
MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGM
A
AAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGE
LLDEAFELAKALAKNNPGWVYIPPFDDPL
I
WEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKL
V
SLPKIT
SVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSH
V
IQKLQLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQLGMTNRLPK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser