NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS9176.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9176.1 Public Homo sapiens 12 TBX3 22 109 92 CCDS HistoryNCBI Gene:6926Re-query CCDS DB by CCDS ID:9176.1Re-query CCDS DB by GeneID:6926See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9176.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000257566.7 ENSP00000257566.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000257566.7Link to Ensembl Protein Viewer:ENSP00000257566.3Re-query CCDS DB by Nucleotide ID:ENST00000257566Re-query CCDS DB by Protein ID:ENSP00000257566
Original member NCBI NM_016569.3 NP_057653.3 Updated not alive Link to Nucleotide Sequence:NM_016569.3Link to Protein Sequence:NP_057653.3Re-query CCDS DB by Nucleotide ID:NM_016569Re-query CCDS DB by Protein ID:NP_057653
Current member NCBI NM_016569.4 NP_057653.3 Accepted alive Link to Nucleotide Sequence:NM_016569.4Link to Protein Sequence:NP_057653.3Re-query CCDS DB by Nucleotide ID:NM_016569Re-query CCDS DB by Protein ID:NP_057653Link to BLAST:NP_057653.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057653.3 743 O15119-1 743 100% 0 0

Chromosomal Locations for CCDS 9176.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 114671841 114672302 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 114674165 114674835 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 114676313 114676470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 114677580 114677656 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 114679505 114679651 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 114679913 114679972 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 114680879 114681146 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 114682812 114683200 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2232 nt):
ATGAGCCTCTCCATGAGAGATCCGGTCATTCCTGGGACAAGCATGGCCTACCATCCGTTCCTACCTCACC
GG
GCGCCGGACTTCGCCATGAGCGCGGTGCTGGGTCACCAGCCGCCGTTCTTCCCCGCGCTGACGCTGCC
T
CCCAACGGCGCGGCGGCGCTCTCGCTGCCGGGCGCCCTGGCCAAGCCGATCATGGATCAATTGGTGGGG
GCG
GCCGAGACCGGCATCCCGTTCTCCTCCCTGGGGCCCCAGGCGCATCTGAGGCCTTTGAAGACCATGG
AG
CCCGAAGAAGAGGTGGAGGACGACCCCAAGGTGCACCTGGAGGCTAAAGAACTTTGGGATCAGTTTCA
C
AAGCGGGGCACCGAGATGGTCATTACCAAGTCGGGAAGGCGAATGTTTCCTCCATTTAAAGTGAGATGT
TCT
GGGCTGGATAAAAAAGCCAAATACATTTTATTGATGGACATTATAGCTGCTGATGACTGTCGTTATA
AA
TTTCACAATTCTCGGTGGATGGTGGCTGGTAAGGCCGACCCCGAAATGCCAAAGAGGATGTACATTCA
C
CCGGACAGCCCCGCTACTGGGGAACAGTGGATGTCCAAAGTCGTCACTTTCCACAAACTGAAACTCACC
AAC
AACATTTCAGACAAACATGGATTTACTTTGGCCTTCCCAAGTGATCACGCTACGTGGCAGGGGAATT
AT
AGTTTTGGTACTCAGACTATATTGAACTCCATGCACAAATACCAGCCCCGGTTCCACATTGTAAGAGC
C
AATGACATCTTGAAACTCCCTTATAGTACATTTCGGACATACTTGTTCCCCGAAACTGAATTCATCGCT
GTG
ACTGCATACCAGAATGATAAGATAACCCAGTTAAAAATAGACAACAACCCTTTTGCAAAAGGTTTCC
GG
GACACTGGAAATGGCCGAAGAGAAAAAAGAAAACAGCTCACCCTGCAGTCCATGAGGGTGTTTGATGA
A
AGACACAAAAAGGAGAATGGGACCTCTGATGAGTCCTCCAGTGAACAAGCAGCTTTCAACTGCTTCGCC
CAG
GCTTCTTCTCCAGCCGCCTCCACTGTAGGGACATCGAACCTCAAAGATTTATGTCCCAGCGAGGGTG
AG
AGCGACGCCGAGGCCGAGAGCAAAGAGGAGCATGGCCCCGAGGCCTGCGACGCGGCCAAGATCTCCAC
C
ACCACGTCGGAGGAGCCCTGCCGTGACAAGGGCAGCCCCGCGGTCAAGGCTCACCTTTTCGCTGCTGAG
CGG
CCCCGGGACAGCGGGCGGCTGGACAAAGCGTCGCCCGACTCACGCCATAGCCCCGCCACCATCTCGT
CC
AGCACTCGCGGCCTGGGCGCGGAGGAGCGCAGGAGCCCGGTTCGCGAGGGCACAGCGCCGGCCAAGGT
G
GAAGAGGCGCGCGCGCTCCCGGGCAAGGAGGCCTTCGCGCCGCTCACGGTGCAGACGGACGCGGCCGCC
GCG
CACCTGGCCCAGGGCCCCCTGCCTGGCCTCGGCTTCGCCCCGGGCCTGGCGGGCCAACAGTTCTTCA
AC
GGGCACCCGCTCTTCCTGCACCCCAGCCAGTTTGCCATGGGGGGCGCCTTCTCCAGCATGGCGGCCGC
T
GGCATGGGTCCCCTCCTGGCCACGGTTTCTGGGGCCTCCACCGGTGTCTCGGGCCTGGATTCCACGGCC
ATG
GCCTCTGCCGCTGCGGCGCAGGGACTGTCCGGGGCGTCCGCGGCCACCCTGCCCTTCCACCTCCAGC
AG
CACGTCCTGGCCTCTCAGGGCCTGGCCATGTCCCCTTTCGGAAGCCTGTTCCCTTACCCCTACACGTA
C
ATGGCCGCAGCGGCGGCCGCCTCCTCTGCGGCAGCCTCCAGCTCGGTGCACCGCCACCCCTTCCTCAAT
CTG
AACACCATGCGCCCGCGGCTGCGCTACAGCCCCTACTCCATCCCGGTGCCGGTCCCGGACGGCAGCA
GT
CTGCTCACCACCGCCCTGCCCTCCATGGCGGCGGCCGCGGGGCCCCTGGACGGCAAAGTCGCCGCCCT
G
GCCGCCAGCCCGGCCTCGGTGGCAGTGGACTCGGGCTCTGAACTCAACAGCCGCTCCTCCACGCTCTCC
TCC
AGCTCCATGTCCTTGTCGCCCAAACTCTGCGCGGAGAAAGAGGCGGCCACCAGCGAACTGCAGAGCA
TC
CAGCGGTTGGTTAGCGGCTTGGAAGCCAAGCCGGACAGGTCCCGCAGCGCGTCCCCGTAG


Translation (743 aa):
MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGALAKPIMDQLVG
A
AETGIPFSSLGPQAHLRPLKTMEPEEEVEDDPKVHLEAKELWDQFHKRGTEMVITKSG
RRMFPPFKVRC
S
GLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLT
N
NISDKHGF
TLAFPSDHATWQGNYSFGTQTILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIA
V
TAYQNDK
ITQLKIDNNPFAKGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNCFA
Q
ASSPAASTVGTSNLK
DLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAE
R
PRDSGRLDKASPDSRHSPATISSSTRGLGAEERRSPVREGTAPAKVEEARALPGKEAFAPLTVQTDAAA
A
HLAQGPLPGLGFAPGLAGQQFFNGHPLFLHPSQFAMGGAFSSMAAAGMGPLLATVSGASTGVSGLDSTA
M
ASAAAAQGLSGASAATLPFHLQQHVLASQ
GLAMSPFGSLFPYPYTYMAAAAAASSAAASSSVHRHPFLN
L
NTMRPRLRYSPYSIPVPVPDGSSLLTTALPSMAAAAGPLDGKVAALAASPASVAVDSGSELNSRSSTLS
S
SSMSLSPKLCAEKEAATSELQSIQRLVSGLEAKPDRSRSASP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser