NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS1076.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1076.1 Public Homo sapiens 1 SHC1 22 109 92 CCDS HistoryNCBI Gene:6464Re-query CCDS DB by CCDS ID:1076.1Re-query CCDS DB by GeneID:6464See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1076.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000368453.8 ENSP00000357438.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000368453.8Link to Ensembl Protein Viewer:ENSP00000357438.4Re-query CCDS DB by Nucleotide ID:ENST00000368453Re-query CCDS DB by Protein ID:ENSP00000357438
Original member Current member NCBI NM_003029.4 NP_003020.2 Accepted alive Link to Nucleotide Sequence:NM_003029.4Link to Protein Sequence:NP_003020.2Re-query CCDS DB by Nucleotide ID:NM_003029Re-query CCDS DB by Protein ID:NP_003020Link to BLAST:NP_003020.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003020.2 474 P29353-7 474 100% 0 0

Chromosomal Locations for CCDS 1076.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 154963803 154963931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154965543 154965781 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154965946 154966080 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154966162 154966231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154966319 154966517 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154967671 154967797 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154967980 154968031 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154968204 154968257 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154968495 154968614 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154968771 154968834 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154969378 154969448 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 154970032 154970196 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1425 nt):
ATGAACAAGCTGAGTGGAGGCGGCGGGCGCAGGACTCGGGTGGAAGGGGGCCAGCTTGGGGGCGAGGAGT
GG
ACCCGCCACGGGAGCTTTGTCAATAAGCCCACGCGGGGCTGGCTGCATCCCAACGACAAAGTCATGGG
A
CCCGGGGTTTCCTACTTGGTTCGGTACATGGGTTGTGTGGAGGTCCTCCAGTCAATGCGTGCCCTGGAC
TTC
AACACCCGGACTCAGGTCACCAGGGAGGCCATCAGTCTGGTGTGTGAGGCTGTGCCGGGTGCTAAGG
GG
GCGACAAGGAGGAGAAAGCCCTGTAGCCGCCCGCTCAGCTCTATCCTGGGGAGGAGTAACCTGAAATT
T
GCTGGAATGCCAATCACTCTCACCGTCTCCACCAGCAGCCTCAACCTCATGGCCGCAGACTGCAAACAG
ATC
ATCGCCAACCACCACATGCAATCTATCTCATTTGCATCCGGCGGGGATCCGGACACAGCCGAGTATG
TC
GCCTATGTTGCCAAAGACCCTGTGAATCAGAGAGCCTGCCACATTCTGGAGTGTCCCGAAGGGCTTGC
C
CAGGATGTCATCAGCACCATTGGCCAGGCCTTCGAGTTGCGCTTCAAACAATACCTCAGGAACCCACCC
AAA
CTGGTCACCCCTCATGACAGGATGGCTGGCTTTGATGGCTCAGCATGGGATGAGGAGGAGGAAGAGC
CA
CCTGACCATCAGTACTATAATGACTTCCCGGGGAAGGAACCCCCCTTGGGGGGGGTGGTAGACATGAG
G
CTTCGGGAAGGAGCCGCTCCAGGGGCTGCTCGACCCACTGCACCCAATGCCCAGACCCCCAGCCACTTG
GGA
GCTACATTGCCTGTAGGACAGCCTGTTGGGGGAGATCCAGAAGTCCGCAAACAGATGCCACCTCCAC
CA
CCCTGTCCAGCAGGCAGAGAGCTTTTTGATGATCCCTCCTATGTCAACGTCCAGAACCTAGACAAGGC
C
CGGCAAGCAGTGGGTGGTGCTGGGCCCCCCAATCCTGCTATCAATGGCAGTGCACCCCGGGACCTGTTT
GAC
ATGAAGCCCTTCGAAGATGCTCTTCGCGTGCCTCCACCTCCCCAGTCGGTGTCCATGGCTGAGCAGC
TC
CGAGGGGAGCCCTGGTTCCATGGGAAGCTGAGCCGGCGGGAGGCTGAGGCACTGCTGCAGCTCAATGG
G
GACTTCCTGGTACGGGAGAGCACGACCACACCTGGCCAGTATGTGCTCACTGGCTTGCAGAGTGGGCAG
CCT
AAGCATTTGCTACTGGTGGACCCTGAGGGTGTGGTTCGGACTAAGGATCACCGCTTTGAAAGTGTCA
GT
CACCTTATCAGCTACCACATGGACAATCACTTGCCCATCATCTCTGCGGGCAGCGAACTGTGTCTACA
G
CAACCTGTGGAGCGGAAACTGTGA


Translation (474 aa):
MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
F
NTRTQVT
REAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQ
I
IANHHMQSISFASGGDP
DTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPP
K
LVTPHD
RMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHL
G
ATL
PVGQPVGGDPEVRKQMPPPPPCPAGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLF
D
M
KPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQ
P
KHLLLVDPEGV
VRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser