NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS47153.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
47153.1 Public Homo sapiens 4 FGG 22 109 92 CCDS HistoryNCBI Gene:2266Re-query CCDS DB by CCDS ID:47153.1Re-query CCDS DB by GeneID:2266See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 47153.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000404648.7 ENSP00000384860.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000404648.7Link to Ensembl Protein Viewer:ENSP00000384860.3Re-query CCDS DB by Nucleotide ID:ENST00000404648Re-query CCDS DB by Protein ID:ENSP00000384860
Original member Current member NCBI NM_000509.5 NP_000500.2 Accepted alive Link to Nucleotide Sequence:NM_000509.5Link to Protein Sequence:NP_000500.2Re-query CCDS DB by Nucleotide ID:NM_000509Re-query CCDS DB by Protein ID:NP_000500Link to BLAST:NP_000500.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000500.2 437 P02679-2 437 100% 0 0

Chromosomal Locations for CCDS 47153.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 154604340 154604354 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 154604897 154605066 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 154606705 154606982 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 154608466 154608650 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 154609630 154609763 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 154610067 154610197 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 154611805 154611898 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 154612018 154612201 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 154612391 154612435 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 154612532 154612609 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1314 nt):
ATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTTTTATTTCTCTCTTCAACAT
GT
GTAGCATATGTTGCTACCAGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAAC
T
ACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAA
GAC
ATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTT
AT
AATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTAGA
A
GAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATAT
AAT
TCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAAC
CT
TGCAAAGACACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGC
T
AAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATC
GAT
GGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACT
GG
ATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGA
G
AAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAAT
GGC
AGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACAT
AT
GCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGA
C
AAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGC
AAC
TGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTT
AT
TACCAAGGTGGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCAC
T
TGGAAAACCCGGTGGTATTCCATGAAGAAAACCACTATGAAGATAATCCCATTCAACAGACTCACAATT
GGA
GAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGCTGGAGACGTTTAA


Translation (437 aa):
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLE
D
ILHQVENKTSEVKQLIKAIQLTYNPDESSKP
NMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIY
N
SNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGK
DCQDIANKGAKQSGLYFIKPLKANQQFLVYCEI
D
GSGNGWTVFQK
RLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWN
G
RT
STADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEG
N
CAEQDGSGWWMNKCHAGHLNGVYYQ
GGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
G
EGQQHHLGGAKQ
AGDV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser