NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27675.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27675.1 Public Mus musculus 15 Aco2 23 108 98 CCDS HistoryNCBI Gene:11429Re-query CCDS DB by CCDS ID:27675.1See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27675.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000023116.6 ENSMUSP00000023116.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023116.6Link to Ensembl Protein Viewer:ENSMUSP00000023116.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000023116Re-query CCDS DB by Protein ID:ENSMUSP00000023116
Original member Current member NCBI NM_080633.2 NP_542364.1 Accepted alive Link to Nucleotide Sequence:NM_080633.2Link to Protein Sequence:NP_542364.1Re-query CCDS DB by Nucleotide ID:NM_080633Re-query CCDS DB by Protein ID:NP_542364Link to BLAST:NP_542364.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_542364.1 780 Q99KI0 780 100% 0 0

Chromosomal Locations for CCDS 27675.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 81872513 81872548 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81889298 81889434 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81895170 81895428 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81899129 81899221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81903476 81903634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81903856 81904006 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81904763 81904867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81905852 81905943 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81907426 81907531 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81909490 81909647 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81909842 81909915 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81910413 81910524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81911886 81912008 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81912206 81912361 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81913106 81913297 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81913680 81913812 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81914238 81914359 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 81914628 81914762 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2343 nt):
ATGGCGCCTTACAGCCTCCTGGTCACCCGGCTGCAGAAGGCCCTGGGTGTGCGGCAGTACCATGTGGCCT
CT
GTCCTGTGCCAACGGGCCAAGGTGGCCATGAGCCATTTTGAGCCCAGTGAGTACATCCGATATGACCT
G
CTAGAGAAGAACATTAACATTGTCCGTAAACGGTTGAACCGGCCTCTTACTCTCTCAGAGAAGATTGTA
TAT
GGACACCTGGATGACCCAGCCAACCAGGAGATCGAGCGGGGAAAGACATACCTGCGTTTACGGCCCG
AC
CGGGTGGCCATGCAGGATGCCACAGCCCAGATGGCTATGCTACAGTTCATTAGCAGTGGGCTGCCTAA
G
GTGGCTGTACCATCAACCATCCACTGTGATCATCTGATTGAGGCCCAGGTTGGGGGTGAGAAAGACCTG
CGC
AGGGCCAAGGACATAAACCAGGAAGTGTATAATTTCCTGGCAACTGCAGGTGCCAAGTATGGTGTGG
GC
TTCTGGAGGCCTGGATCTGGGATCATTCACCAGATCATTCTAGAAAACTATGCATACCCTGGAGTTCT
T
CTGATCGGCACTGATTCGCACACCCCCAATGGTGGTGGCCTGGGAGGCATCTGCATTGGAGTAGGGGGT
GCT
GATGCTGTGGATGTCATGGCTGGGATCCCCTGGGAGCTGAAGTGTCCCAAGGTGATCGGTGTGAAGC
TG
ACAGGCTCCCTCTCTGGTTGGACCTCACCCAAAGATGTGATCCTGAAAGTGGCAGGTATCCTCACGGT
G
AAAGGTGGCACAGGTGCTATTGTGGAATACCACGGACCCGGTGTCGATTCCATCTCCTGCACTGGCATG
GCA
ACTATCTGCAACATGGGTGCAGAAATTGGGGCCACTACGTCAGTGTTCCCATACAACCACAGGATGA
AA
AAGTACCTGAGCAAGACAGGCCGAACAGACATTGCCAACCTAGCAGAAGAATTCAAGGATCACTTAGT
G
CCTGATCCTGGCTGCCAGTATGACCAAGTGATTGAAATTAACCTCAATGAGCTAAAGCCACATATCAAT
GGG
CCCTTTACCCCTGACTTGGCTCACCCAGTGGCAGATGTGGGGACTGTGGCAGAGAAGGAAGGCTGGC
CT
CTGGACATCAGAGTAGGTTTGATTGGCAGCTGCACCAATTCAAGCTATGAGGACATGGGACGATCAGC
A
GCTGTGGCTAAGCAGGCATTGGCCCACGGACTCAAGTGCAAGTCCCAGTTCACCATCACCCCAGGCTCT
GAG
CAGATCCGTGCCACTATTGAGCGGGATGGCTATGCACAGATCTTAAGGGATGTGGGTGGAATCGTTT
TG
GCCAATGCCTGTGGCCCTTGCATCGGCCAGTGGGACAGAAAAGACATCAAGAAGGGGGAGAAGAATAC
A
ATCGTCACCTCTTACAACAGGAACTTCACAGGCCGTAATGATGCAAACCCTGAGACCCATGCCTTTGTC
ACA
TCCCCAGAGATTGTCACAGCTCTGGCCATTGCAGGAACCCTGAAGTTCAATCCAGAAACTGACTTCT
TA
ACAGGCAAGGACGGCAAGAAGTTCAAGTTGGAGGCTCCAGATGCAGACGAGCTTCCCCGATCGGACTT
T
GATCCAGGGCAGGACACATACCAGCACCCCCCTAAGGACAGCAGTGGGCAGCGGGTGGACGTGAGCCCT
ACC
AGCCAGCGCCTGCAGCTCCTGGAGCCTTTCGACAAGTGGGACGGCAAAGACCTCGAGGACCTGCAAA
TC
CTCATCAAGGTCAAAGGGAAGTGCACCACAGACCACATTTCTGCTGCCGGCCCCTGGCTCAAGTTCCG
T
GGGCATCTGGATAACATCTCTAACAACCTGCTCATCGGTGCCATCAACATCGAAAATGGCAAAGCCAAC
TCT
GTACGCAATGCTGTCACCCAGGAGTTTGGCCCTGTACCTGACACTGCTCGCTACTACAAGAAACATG
GC
ATCAGGTGGGTGGTGATTGGAGATGAGAACTATGGTGAGGGCTCAAGCCGGGAGCATGCAGCACTGGA
G
CCTCGCCACCTTGGGGGCCGGGCCATCATCACCAAGAGCTTCGCCAGGATCCACGAAACCAATCTAAAG
AAG
CAGGGCTTGCTGCCCCTCACCTTCGCTGACCCCTCCGACTATAACAAGATTCATCCAGTGGACAAGC
TG
ACCATTCAAGGCCTGAAGGACTTTGCCCCTGGAAAGCCTCTGAAGTGCGTCATCAAGCACCCCAATGG
G
ACCCAGGAGACCATCCTCCTGAACCACACCTTCAACGAGACCCAGATCGAGTGGTTCCGTGCAGGCAGT
GCC
CTCAACAGGATGAAGGAGCTGCAGCAGTGA


Translation (780 aa):
MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPSEYIRYDLLEKNINIVRKRLNRPLTLSEKIV
Y
GHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQVGGEKDL
R
RAK
DINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGG
A
DAVDVMAGIPWELKCPK
VIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGM
A
TICNMGAEIGATTSVFPYNHRMKKYLSKTGRT
DIANLAEEFKDHLVPDPGCQYDQVIEINLNELKPHIN
G
PFTPDLAHPVADVGTVAEKEGWPLDIRV
GLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGS
E
QIRATIERDGY
AQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFV
T
SPE
IVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPRSDFDPGQDTYQHPPKDSSGQRVDVSP
T
SQRLQLLEPFDKWDGKDLEDLQILIK
VKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKAN
S
VRNAVTQEFGPVPDTARYYK
KHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLK
K
QGLLPLTFADPSDYNKIHPVDKLTIQGLKDFAPGK
PLKCVIKHPNGTQETILLNHTFNETQIEWFRAGS
A
LNRMKELQQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser