NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS23134.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23134.1 Public Mus musculus 9 Fxyd2 23 108 98 CCDS HistoryNCBI Gene:11936Re-query CCDS DB by CCDS ID:23134.1See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 23134.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000041005.5 ENSMUSP00000035429.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000041005.5Link to Ensembl Protein Viewer:ENSMUSP00000035429.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000041005Re-query CCDS DB by Protein ID:ENSMUSP00000035429
Original member NCBI NM_052823.2 NP_439888.1 Updated not alive Link to Nucleotide Sequence:NM_052823.2Link to Protein Sequence:NP_439888.1Re-query CCDS DB by Nucleotide ID:NM_052823Re-query CCDS DB by Protein ID:NP_439888
Current member NCBI NM_052823.3 NP_439888.1 Accepted alive Link to Nucleotide Sequence:NM_052823.3Link to Protein Sequence:NP_439888.1Re-query CCDS DB by Nucleotide ID:NM_052823Re-query CCDS DB by Protein ID:NP_439888Link to BLAST:NP_439888.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_439888.1 64 Q04646-2 64 100% 0 0

Chromosomal Locations for CCDS 23134.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 45403282 45403300 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 45408106 45408144 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 45408300 45408374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 45409513 45409549 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 45409703 45409727 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (195 nt):
ATGGACAGGTGGTACCTGGGTGGCAGTGCCAAGGGGACAGAGAATCCCTTCGAGTACGACTATGAAACCG
TC
CGCAAAGGAGGCCTGATCTTCGCGGGCCTGGCCTTCGTCGTGGGCCTCCTCATCATTCTCAGCAAAAG
G
TTCCGCTGTGGGGGCGGTAAGAAACATAGGCAGGTCAATGAAGATGAACTGTGA


Translation (64 aa):
MDRWYLGGSAKGTENPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRCGGGKKHRQVNEDEL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser