NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS21010.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21010.1 Public Mus musculus 7 Cyp2f2 23 108 98 CCDS HistoryNCBI Gene:13107Re-query CCDS DB by CCDS ID:21010.1See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21010.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000003100.9 ENSMUSP00000003100.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000003100.9Link to Ensembl Protein Viewer:ENSMUSP00000003100.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000003100Re-query CCDS DB by Protein ID:ENSMUSP00000003100
Original member Current member NCBI NM_007817.2 NP_031843.2 Accepted alive Link to Nucleotide Sequence:NM_007817.2Link to Protein Sequence:NP_031843.2Re-query CCDS DB by Nucleotide ID:NM_007817Re-query CCDS DB by Protein ID:NP_031843Link to BLAST:NP_031843.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031843.2 491 P33267 491 100% 0 0

Chromosomal Locations for CCDS 21010.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 27121571 27121741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 27121835 27121997 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 27124854 27125003 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 27129191 27129351 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 27129717 27129893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 27130294 27130435 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 27131170 27131357 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 27132474 27132615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 27133216 27133397 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1476 nt):
ATGGATGGTGTGAGCACAGCCATCTTGCTTCTCCTCCTGGCTGTCATCTCTCTGTCCCTGACCTTCAGCT
CA
CGGGGCAAGGGCCAGCTGCCTCCAGGACCCAAACCTCTCCCAATCCTGGGAAACCTGCTGCAGCTTCG
C
TCCCAAGACTTGCTGACCTCCCTCACCAAGCTTAGCAAGGAGTATGGGTCGGTGTTCACGGTGTACCTG
GGG
TCCAGGCCTGTGATAGTCCTCAGCGGATACCAAACTGTGAAGGAGGCTCTTGTGGACAAAGGGGAGG
AG
TTCAGTGGCCGAGGCGCATACCCCGTCTTTTTCAACTTCACCAGGGGCAACGGCATCGCCTTCTCCGA
T
GGAGAGCGCTGGAAGATCCTCAGAAGGTTCTCTGTCCAAATCCTGCGGAACTTTGGCATGGGAAAAAGA
AGC
ATCGAGGAGCGGATCCTGGAAGAAGGCAGCTTCCTGCTGGAGGTGCTGAGGAAAATGGAAGGCAAGC
CC
TTTGACCCCGTGTTTATCCTGAGCCGCTCTGTGTCCAACATTATCTGCTCTGTCGTCTTCGGAAGTCG
C
TTCGACTATGACGATGAGCGTCTGCTCACCATCATCCACTTTATCAATGACAACTTCAAGATTATGAGC
AGC
CCTTGGGGCGAGATGTACAACATCTTCCCAAGTGTCCTTGATTGGATACCTGGGCCACACAAACGCT
TG
TTCCGGAACTTTGGAGGCATGAAAGATCTCATTGCCCGCAGCGTCCGCGAACACCAGGATTCCCTGGA
C
CCCAACTCTCCCCGGGACTTCATCGACTGCTTCCTCACAAAGATGGCACAGGAGAAGCAAGACCCACTG
AGC
CACTTCAATATGGATACCCTGCTGATGACCACACACAACCTGCTCTTCGGTGGCACAGAAACCGTGG
GC
ACCACACTGCGTCACGCCTTCCTTATTCTTATGAAATACCCCAAAGTGCAAGCCCGCGTGCAGGAAGA
G
ATTGACCGTGTGGTGGGGCGCTCGCGGATGCCGACGCTGGAAGACCGTACATCCATGCCTTACACAGAT
GCA
GTGATCCACGAAGTGCAACGCTTTGCTGACGTCATCCCCATGAACCTGCCTCACCGTGTCACTCGGG
AC
ACACCTTTCCGGGGCTTCCTGATACCCAAGGGCACAGATGTCATCACACTCCTTAACACTGTGCACTA
C
GACTCGGACCAGTTCAAGACGCCTCAGGAGTTCAATCCTGAACATTTTCTGGACGACAATCATTCTTTC
AAA
AAGAGCCCCGCCTTCATGCCATTTTCGGCTGGACGTCGACTGTGTCTGGGAGAGCCACTGGCGCGCA
TG
GAGCTCTTCATATACTTCACCTCCATTCTGCAGAACTTCACATTGCAGCCGCTGGTGGATCCTGAGGA
C
ATCGACCTGACCCCGCTCAGCTCAGGGCTGGGCAATTTGCCAAGGCCTTTCCAGCTGTGTATGCACATT
CGC
TGA


Translation (491 aa):
MDGVSTAILLLLLAVISLSLTFSSRGKGQLPPGPKPLPILGNLLQLRSQDLLTSLTKLSKEYGSVFTVYL
G
SRPVIVLSGYQTVKEALVDKGEEFSGRGAYPVFFNFTRGN
GIAFSDGERWKILRRFSVQILRNFGMGKR
S
IEERILEEGSFLLEVLRKME
GKPFDPVFILSRSVSNIICSVVFGSRFDYDDERLLTIIHFINDNFKIMS
S
PWGE
MYNIFPSVLDWIPGPHKRLFRNFGGMKDLIARSVREHQDSLDPNSPRDFIDCFLTKMAQEKQDPL
S
HFNMDTLLMTTHNLLFGGTETVGTTLRHAFLILMKYPKVQ
ARVQEEIDRVVGRSRMPTLEDRTSMPYTD
A
VIHEVQRFADVIPMNLPHRVTRDTPFRGFLIPK
GTDVITLLNTVHYDSDQFKTPQEFNPEHFLDDNHSF
K
KSPAFMPFSA
GRRLCLGEPLARMELFIYFTSILQNFTLQPLVDPEDIDLTPLSSGLGNLPRPFQLCMHI
R




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser