NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS3810.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3810.1 Public Homo sapiens 4 CPE 22 109 92 CCDS HistoryNCBI Gene:1363Re-query CCDS DB by CCDS ID:3810.1See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3810.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000402744.8 ENSP00000386104.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000402744.8Link to Ensembl Protein Viewer:ENSP00000386104.4Re-query CCDS DB by Nucleotide ID:ENST00000402744Re-query CCDS DB by Protein ID:ENSP00000386104
Original member NCBI NM_001873.3 NP_001864.1 Updated not alive Link to Nucleotide Sequence:NM_001873.3Link to Protein Sequence:NP_001864.1Re-query CCDS DB by Nucleotide ID:NM_001873Re-query CCDS DB by Protein ID:NP_001864
Current member NCBI NM_001873.4 NP_001864.1 Accepted alive Link to Nucleotide Sequence:NM_001873.4Link to Protein Sequence:NP_001864.1Re-query CCDS DB by Nucleotide ID:NM_001873Re-query CCDS DB by Protein ID:NP_001864Link to BLAST:NP_001864.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001864.1 476 P16870-1 476 100% 0 0

Chromosomal Locations for CCDS 3810.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 165379222 165379528 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 165464390 165464586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 165467688 165467855 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 165482242 165482359 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 165484422 165484604 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 165487438 165487577 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 165493171 165493270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 165495559 165495677 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 165497512 165497610 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1431 nt):
ATGGCCGGGCGAGGGGGCAGCGCGCTGCTGGCTCTGTGCGGGGCACTGGCTGCCTGCGGGTGGCTCCTGG
GC
GCCGAAGCCCAGGAGCCCGGGGCGCCCGCGGCGGGCATGAGGCGGCGCCGGCGGCTGCAGCAAGAGGA
C
GGCATCTCCTTCGAGTACCACCGCTACCCCGAGCTGCGCGAGGCGCTCGTGTCCGTGTGGCTGCAGTGC
ACC
GCCATCAGCAGGATTTACACGGTGGGGCGCAGCTTCGAGGGCCGGGAGCTCCTGGTCATCGAGCTGT
CC
GACAACCCTGGCGTCCATGAGCCTGGTGAGCCTGAATTTAAATACATTGGGAATATGCATGGGAATGA
G
GCTGTTGGACGAGAACTGCTCATTTTCTTGGCCCAGTACCTATGCAACGAATACCAGAAGGGGAACGAG
ACA
ATTGTCAACCTGATCCACAGTACCCGCATTCACATCATGCCTTCCCTGAACCCAGATGGCTTTGAGA
AG
GCAGCGTCTCAGCCTGGTGAACTCAAGGACTGGTTTGTGGGTCGAAGCAATGCCCAGGGAATAGATCT
G
AACCGGAACTTTCCAGACCTGGATAGGATAGTGTACGTGAATGAGAAAGAAGGTGGTCCAAATAATCAT
CTG
TTGAAAAATATGAAGAAAATTGTGGATCAAAACACAAAGCTTGCTCCTGAGACCAAGGCTGTCATTC
AT
TGGATTATGGATATTCCTTTTGTGCTTTCTGCCAATCTCCATGGAGGAGACCTTGTGGCCAATTATCC
A
TATGATGAGACGCGGAGTGGTAGTGCTCACGAATACAGCTCCTCCCCAGATGACGCCATTTTCCAAAGC
TTG
GCCCGGGCATACTCTTCTTTCAACCCGGCCATGTCTGACCCCAATCGGCCACCATGTCGCAAGAATG
AT
GATGACAGCAGCTTTGTAGATGGAACCACCAACGGTGGTGCTTGGTACAGCGTACCTGGAGGGATGCA
A
GACTTCAATTACCTTAGCAGCAACTGTTTTGAGATCACCGTGGAGCTTAGCTGTGAGAAGTTCCCACCT
GAA
GAGACTCTGAAGACCTACTGGGAGGATAACAAAAACTCCCTCATTAGCTACCTTGAGCAGATACACC
GA
GGAGTTAAAGGATTTGTCCGAGACCTTCAAGGTAACCCAATTGCGAATGCCACCATCTCCGTGGAAGG
A
ATAGACCACGATGTTACATCCGCAAAGGATGGTGATTACTGGAGATTGCTTATACCTGGAAACTATAAA
CTT
ACAGCCTCAGCTCCAGGCTATCTGGCAATAACAAAGAAAGTGGCAGTTCCTTACAGCCCTGCTGCTG
GG
GTTGATTTTGAACTGGAGTCATTTTCTGAAAGGAAAGAAGAGGAGAAGGAAGAATTGATGGAATGGTG
G
AAAATGATGTCAGAAACTTTAAATTTTTAA


Translation (476 aa):
MAGRGGSALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELREALVSVWLQC
T
AISRIYTVGRSFEGRELLVIELSDNPGVHEP
GEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNE
T
IVNLIHSTRIHIMPSLNPDGFEKAASQ
PGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNH
L
LKNMKKIVDQNTK
LAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQS
L
ARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPG
GMQDFNYLSSNCFEITVELSCEKFPP
E
ETLKTYWEDNKNSLISYLEQ
IHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNYK
L
TASAPGYLAITKKVAVPYSPAAG
VDFELESFSERKEEEKEELMEWWKMMSETLNF



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser