NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS3011.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3011.1 Public Homo sapiens 3 CSTA 22 109 92 CCDS HistoryNCBI Gene:1475Re-query CCDS DB by CCDS ID:3011.1See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3011.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000264474.3 ENSP00000264474.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000264474.3Link to Ensembl Protein Viewer:ENSP00000264474.3Re-query CCDS DB by Nucleotide ID:ENST00000264474Re-query CCDS DB by Protein ID:ENSP00000264474
Original member NCBI NM_005213.3 NP_005204.1 Updated not alive Link to Nucleotide Sequence:NM_005213.3Link to Protein Sequence:NP_005204.1Re-query CCDS DB by Nucleotide ID:NM_005213Re-query CCDS DB by Protein ID:NP_005204
Current member NCBI NM_005213.4 NP_005204.1 Accepted alive Link to Nucleotide Sequence:NM_005213.4Link to Protein Sequence:NP_005204.1Re-query CCDS DB by Nucleotide ID:NM_005213Re-query CCDS DB by Protein ID:NP_005204Link to BLAST:NP_005204.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005204.1 98 P01040 98 100% 0 0

Chromosomal Locations for CCDS 3011.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 122325293 122325358 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 122337547 122337648 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 122341439 122341567 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (297 nt):
ATGATACCTGGAGGCTTATCTGAGGCCAAACCCGCCACTCCAGAAATCCAGGAGATTGTTGATAAGGTTA
AA
CCACAGCTTGAAGAAAAAACAAATGAGACTTACGGAAAATTGGAAGCTGTGCAGTATAAAACTCAAGT
T
GTTGCTGGAACAAATTACTACATTAAGGTACGAGCAGGTGATAATAAATATATGCACTTGAAAGTATTC
AAA
AGTCTTCCCGGACAAAATGAGGACTTGGTACTTACTGGATACCAGGTTGACAAAAACAAGGATGACG
AG
CTGACGGGCTTTTAG


Translation (98 aa):
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVF
K
SLPGQNEDLVLTGYQVDKNKDDELTGF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser