NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS13701.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13701.1 Public Homo sapiens 21 CSTB 22 109 92 CCDS HistoryNCBI Gene:1476Re-query CCDS DB by CCDS ID:13701.1See the combined annotation on chromosome 21 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13701.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000291568.6 ENSP00000291568.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000291568.6Link to Ensembl Protein Viewer:ENSP00000291568.5Re-query CCDS DB by Nucleotide ID:ENST00000291568Re-query CCDS DB by Protein ID:ENSP00000291568
Original member NCBI NM_000100.3 NP_000091.1 Updated not alive Link to Nucleotide Sequence:NM_000100.3Link to Protein Sequence:NP_000091.1Re-query CCDS DB by Nucleotide ID:NM_000100Re-query CCDS DB by Protein ID:NP_000091
Current member NCBI NM_000100.4 NP_000091.1 Accepted alive Link to Nucleotide Sequence:NM_000100.4Link to Protein Sequence:NP_000091.1Re-query CCDS DB by Nucleotide ID:NM_000100Re-query CCDS DB by Protein ID:NP_000091Link to BLAST:NP_000091.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000091.1 98 P04080 98 100% 0 0

Chromosomal Locations for CCDS 13701.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 21 (NC_000021.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21See the combined annotation on chromosome 21 in Sequence Viewer

Chromosome Start Stop Links
21 43774202 43774330 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 43774658 43774759 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 43776204 43776269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (297 nt):
ATGATGTGCGGGGCGCCCTCCGCCACGCAGCCGGCCACCGCCGAGACCCAGCACATCGCCGACCAGGTGA
GG
TCCCAGCTTGAAGAGAAAGAAAACAAGAAGTTCCCTGTGTTTAAGGCCGTGTCATTCAAGAGCCAGGT
G
GTCGCGGGGACAAACTACTTCATCAAGGTGCACGTCGGCGACGAGGACTTCGTACACCTGCGAGTGTTC
CAA
TCTCTCCCTCATGAAAACAAGCCCTTGACCTTATCTAACTACCAGACCAACAAAGCCAAGCATGATG
AG
CTGACCTATTTCTGA


Translation (98 aa):
MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVF
Q
SLPHENKPLTLSNYQTNKAKHDELTYF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser