NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS37583.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37583.1 Public Mus musculus 17 H2-Ab1 23 108 98 CCDS HistoryNCBI Gene:14961Re-query CCDS DB by CCDS ID:37583.1See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37583.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000040828.6 ENSMUSP00000041008.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000040828.6Link to Ensembl Protein Viewer:ENSMUSP00000041008.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000040828Re-query CCDS DB by Protein ID:ENSMUSP00000041008
Original member Current member NCBI NM_207105.3 NP_996988.2 Accepted alive Link to Nucleotide Sequence:NM_207105.3Link to Protein Sequence:NP_996988.2Re-query CCDS DB by Nucleotide ID:NM_207105Re-query CCDS DB by Protein ID:NP_996988Link to BLAST:NP_996988.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_996988.2 265 P14483 265 100% 0 0

Chromosomal Locations for CCDS 37583.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 34263312 34263405 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 34264761 34265033 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 34267336 34267617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 34267923 34268033 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 34268461 34268484 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 34269095 34269108 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (798 nt):
ATGGCTCTGCAGATCCCCAGCCTCCTCCTCTCGGCTGCTGTGGTGGTGCTGATGGTGCTGAGCAGCCCAG
GG
ACTGAGGGCGGAGACTCCGAAAGGCATTTCGTGTACCAGTTCATGGGCGAGTGCTACTTCACCAACGG
G
ACGCAGCGCATACGATATGTGACCAGATACATCTACAACCGGGAGGAGTACGTGCGCTACGACAGCGAC
GTG
GGCGAGCACCGCGCGGTGACCGAGCTGGGGCGGCCAGACGCCGAGTACTGGAACAGCCAGCCGGAGA
TC
CTGGAGCGAACGCGGGCCGAGCTGGACACGGTGTGCAGACACAACTACGAGGGGCCGGAGACCCACAC
C
TCCCTGCGGCGGCTTGAACAGCCCAATGTCGTCATCTCCCTGTCCAGGACAGAGGCCCTCAACCACCAC
AAC
ACTCTGGTCTGCTCAGTGACAGATTTCTACCCAGCCAAGATCAAAGTGCGCTGGTTCCGGAATGGCC
AG
GAGGAGACGGTGGGGGTCTCATCCACACAGCTTATTAGGAATGGGGACTGGACCTTCCAGGTCCTGGT
C
ATGCTGGAGATGACCCCTCGGCGGGGAGAGGTCTACACCTGTCACGTGGAGCATCCCAGCCTGAAGAGC
CCC
ATCACTGTGGAGTGGAGGGCACAGTCTGAGTCTGCCTGGAGCAAGATGTTGAGCGGCATCGGGGGCT
GC
GTGCTTGGGGTGATCTTCCTCGGGCTTGGCCTTTTCATCCGTCACAGGAGTCAGAAAGGACCTCGAGG
C
CCTCCTCCAGCAGGGCTCCTGCAGTGA


Translation (265 aa):
MALQIPSLLLSAAVVVLMVLSSPGTEGGDSERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSD
V
GEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRL
EQPNVVISLSRTEALNHH
N
TLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKS
P
ITVEW
RAQSESAWSKMLSGIGGCVLGVIFLGLGLFIRHRSQKGPRGPPPAGLLQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser