NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS37222.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37222.1 Public Mus musculus 15 Krt4 23 108 98 CCDS HistoryNCBI Gene:16682Re-query CCDS DB by CCDS ID:37222.1See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37222.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000023797.7 ENSMUSP00000023797.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023797.7Link to Ensembl Protein Viewer:ENSMUSP00000023797.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000023797Re-query CCDS DB by Protein ID:ENSMUSP00000023797
Original member Current member NCBI NM_008475.2 NP_032501.2 Accepted alive Link to Nucleotide Sequence:NM_008475.2Link to Protein Sequence:NP_032501.2Re-query CCDS DB by Nucleotide ID:NM_008475Re-query CCDS DB by Protein ID:NP_032501Link to BLAST:NP_032501.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032501.2 525 P07744 525 100% 0 0

Chromosomal Locations for CCDS 37222.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 101919025 101919194 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101919289 101919323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101919536 101919756 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101920276 101920401 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101920551 101920715 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101921231 101921326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101921712 101921772 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101922761 101922975 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101924182 101924670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1578 nt):
ATGATCGCCAGACAGTCAAGTGTCCGCGGAGCCTCCCGGGGCTTTAGCAGTGGCTCAGCTATTGCTGGTG
GT
GTCAAGCGAGTGGCCTTTAGCTCAGGCTCCATGTCTGGCGGTGCAGGGCGCTGCTCTTCTGGGGGCTT
C
GGCAGCAGAAGTCTTTACAACCTCGGGGGTCACAAGAGTATCTCCATGAGCGTGGCTGGGTCCTGCCAA
GGC
GGCGGCTATGGGGGTGCCGGAGGCTTCGGCGTTGGAGGATACGGTGCTGGGTTTGGTGCCGGTGGTT
TT
GGCGGTGGCTTTGGAGGCTCCTTCAACGGTCGAGGAGGTCCTGGCTTCCCAGTCTGTCCTGCTGGAGG
T
ATTCAGGAAGTCACCATCAACCAGAGCCTGCTGACACCTCTTCAGGTGGAGATTGACCCAGAGATCCAG
AAA
ATCCGCACGGCGGAGCGTGAGCAGATCAAGACCCTCAACAACAAATTCGCGTCCTTCATCGATAAGG
TG
CGATTCTTAGAGCAACAGAACAAGGTCCTGGAGACCAAATGGAACCTCCTCCAGCAGCAGACAACCAC
C
ACATCTCCCAAAAGCCTGGATCCTTTCTTTGAGACTTACATCAACGCCTTGAGGAAGAACCTGGACACT
TTG
AGCAATGACAAAGGTCGCCTACAGTCAGAGCTAAAGATGATGCAGGACAGTGTGGAGGACTTCAAGA
CC
AAGTATGAAGAGGAGATCAACAAGCGTACAGCTGCAGAGAATGACTTCGTGGTCCTCAAGAAAGATGT
G
GATGCTGCCTACATGATCAAGGTGGAGTTAGAGGCCAAGATGGAAAGCCTTAAGGATGAGATCAACTTC
ACG
AGAGTCCTCTATGAAGCGGAGCTGGCCCAGATGCAGACACATGTCTCAGACACATCTGTAGTGCTGT
CC
ATGGACAACAACCGGAACCTGGACCTGGATGGCATCATCGCAGAGGTCCGGGCCCAGTATGAGGACAT
T
GCTAGGAAGAGCAAGGCTGAGGTTGAATCCTGGTACCAGATCAAGGTCCAGCAGCTCCAGATGTCAGCT
GAC
CAACATGGAGATAGCCTGAAGACCACCAAGAATGAGATCTCAGAACTCAACAGGATGATCCAGAGGC
TG
CGGGCAGAGATTGAGAACATCAAGAAGCAGAGCCAGACTCTGCAGGCATCTGTGGCTGATGCAGAGCA
G
CGTGGAGAGCTGGCCCTCAAAGATGCCTACAGCAAACGCGCAGAACTGGAGACTGCACTGCAGAAGGCC
AAG
GAGGACCTGGCCCGGCTGCTGAGGGACTACCAGGCTCTCATGAACGTCAAGCTGGCCCTGGATGTGG
AG
ATTGCCACCTACAGGAAGCTGCTGGAGGGCGAGGAGTGCAGGATGTCTGGAGAATGCAAGAGTGCTGT
G
AGCATCTCGGTAGTTGGCGGCAGCGCCAGCATTGGCGGCAGTGGCCTTGGCCTGGGTAGCGGTTTTTGC
TCC
GGTTCTGGTTCTGGAAGTGGCTTTGGATTTGGTGGTGGCATTTATGGCGGTTCTGGTTCCAAGATCA
CC
TCTTCCGCCACCATCACCAAGAGGTCCCCACGATAG


Translation (525 aa):
MIARQSSVRGASRGFSSGSAIAGGVKRVAFSSGSMSGGAGRCSSGGFGSRSLYNLGGHKSISMSVAGSCQ
G
GGYGGAGGFGVGGYGAGFGAGGFGGGFGGSFNGRGGPGFPVCPAGGIQEVTINQSLLTPLQVEIDPEIQ
K
IRTAEREQIKTLNNKFASFIDK
VRFLEQQNKVLETKWNLLQQQTTTTSPKSLDPFFETYINALRKNLDT
L
SNDKGRLQSELKMMQDSVEDFKT
KYEEEINKRTAAENDFVVLKKDVDAAYMIKVELEAKMESLKDEINF
T
RVLYEA
ELAQMQTHVSDTSVVLSMDNNRNLDLDGIIAEVRAQYEDIARKSKAEVESWYQIKVQQLQMSA
D
QHGDSLKTTKNEISELNRMIQRLRAEIENIKKQ
SQTLQASVADAEQRGELALKDAYSKRAELETALQKA
K
EDLARLLRDYQALMNVKLALDVEIATYRKLLEGEEC
RMSGECKSAVSISVVGGSASIGGSGLGLGSGFC
S
GSGSGSGFGFGGGIYGGSGSKITSSATITKRSPR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser