NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS15913.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15913.1 Public Mus musculus 2 Lcn2 23 108 98 CCDS HistoryNCBI Gene:16819Re-query CCDS DB by CCDS ID:15913.1See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 15913.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000050785.13 ENSMUSP00000053962.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000050785.13Link to Ensembl Protein Viewer:ENSMUSP00000053962.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000050785Re-query CCDS DB by Protein ID:ENSMUSP00000053962
Original member Current member NCBI NM_008491.1 NP_032517.1 Accepted alive Link to Nucleotide Sequence:NM_008491.1Link to Protein Sequence:NP_032517.1Re-query CCDS DB by Nucleotide ID:NM_008491Re-query CCDS DB by Protein ID:NP_032517Link to BLAST:NP_032517.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032517.1 200 P11672 200 100% 0 0

Chromosomal Locations for CCDS 15913.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 32384865 32384884 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32385419 32385520 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32385706 32385825 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32385956 32386041 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32387028 32387164 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32387580 32387717 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (603 nt):
ATGGCCCTGAGTGTCATGTGTCTGGGCCTTGCCCTGCTTGGGGTCCTGCAGAGCCAGGCCCAGGACTCAA
CT
CAGAACTTGATCCCTGCCCCATCTCTGCTCACTGTCCCCCTGCAGCCAGACTTCCGGAGCGATCAGTT
C
CGGGGCAGGTGGTACGTTGTGGGCCTGGCAGGCAATGCGGTCCAGAAAAAAACAGAAGGCAGCTTTACG
ATG
TACAGCACCATCTATGAGCTACAAGAGAACAATAGCTACAATGTCACCTCCATCCTGGTCAGGGACC
AG
GACCAGGGCTGTCGCTACTGGATCAGAACATTTGTTCCAAGCTCCAGGGCTGGCCAGTTCACTCTGGG
A
AATATGCACAGGTATCCTCAGGTACAGAGCTACAATGTGCAAGTGGCCACCACGGACTACAACCAGTTC
GCC
ATGGTATTTTTCCGAAAGACTTCTGAAAACAAGCAATACTTCAAAATTACCCTGTATGGAAGAACCA
AG
GAGCTGTCCCCTGAACTGAAGGAACGTTTCACCCGCTTTGCCAAGTCTCTGGGCCTCAAGGACGACAA
C
ATCATCTTCTCTGTCCCCACCGACCAATGCATTGACAACTGA


Translation (200 aa):
MALSVMCLGLALLGVLQSQAQDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFT
M
YSTIYELQENNSYNVTSILV
RDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQF
A
MVFFRKTSENKQYFKITLY
GRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser