NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27609.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27609.1 Public Mus musculus 15 Pvalb 23 108 98 CCDS HistoryNCBI Gene:19293Re-query CCDS DB by CCDS ID:27609.1See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27609.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000005860.15 ENSMUSP00000005860.9 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000005860.15Link to Ensembl Protein Viewer:ENSMUSP00000005860.9Re-query CCDS DB by Nucleotide ID:ENSMUST00000005860Re-query CCDS DB by Protein ID:ENSMUSP00000005860
Original member Current member EBI ENSMUST00000120592.1 ENSMUSP00000112598.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000120592.1Link to Ensembl Protein Viewer:ENSMUSP00000112598.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000120592Re-query CCDS DB by Protein ID:ENSMUSP00000112598
Original member Current member NCBI NM_001330686.1 NP_001317615.1 Accepted alive Link to Nucleotide Sequence:NM_001330686.1Link to Protein Sequence:NP_001317615.1Re-query CCDS DB by Nucleotide ID:NM_001330686Re-query CCDS DB by Protein ID:NP_001317615Link to BLAST:NP_001317615.1
Original member Current member NCBI NM_013645.4 NP_038673.2 Accepted alive Link to Nucleotide Sequence:NM_013645.4Link to Protein Sequence:NP_038673.2Re-query CCDS DB by Nucleotide ID:NM_013645Re-query CCDS DB by Protein ID:NP_038673Link to BLAST:NP_038673.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001317615.1 110 P32848 110 100% 0 0
NP_038673.2 110 P32848 110 100% 0 0

Chromosomal Locations for CCDS 27609.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 78191666 78191694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 78201226 78201335 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 78202521 78202653 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 78204085 78204145 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (333 nt):
ATGTCGATGACAGACGTGCTCAGCGCTGAGGACATCAAGAAGGCGATAGGAGCCTTTGCTGCTGCAGACT
CC
TTCGACCACAAAAAGTTCTTCCAGATGGTGGGCCTGAAGAAAAAGAACCCGGATGAGGTGAAGAAGGT
G
TTCCATATTCTGGACAAAGACAAAAGTGGCTTCATTGAGGAGGATGAGCTGGGGTCCATTCTGAAGGGC
TTC
TCCTCAGATGCCAGAGACTTGTCTGCTAAAGAAACAAAGACGCTTCTGGCCGCTGGAGACAAGGATG
GG
GACGGCAAGATTGGGGTTGAAGAATTCTCCACTCTGGTGGCTGAAAGCTAA


Translation (110 aa):
MSMTDVLSAEDIKKAIGAFAAADSFDHKKFFQMVGLKKKNPDEVKKVFHILDKDKSGFIEEDELGSILKG
F
SSDARDLSAKETKTLLAAGDKDGDGKIGVE
EFSTLVAES



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser