NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS21282.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21282.1 Public Mus musculus 7 Saa3 23 108 98 CCDS HistoryNCBI Gene:20210Re-query CCDS DB by CCDS ID:21282.1See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 21282.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000006956.8 ENSMUSP00000006956.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000006956.8Link to Ensembl Protein Viewer:ENSMUSP00000006956.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000006956Re-query CCDS DB by Protein ID:ENSMUSP00000006956
Original member Current member NCBI NM_011315.3 NP_035445.1 Accepted alive Link to Nucleotide Sequence:NM_011315.3Link to Protein Sequence:NP_035445.1Re-query CCDS DB by Nucleotide ID:NM_011315Re-query CCDS DB by Protein ID:NP_035445Link to BLAST:NP_035445.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035445.1 122 P04918 122 100% 0 0

Chromosomal Locations for CCDS 21282.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 46712126 46712264 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 46712589 46712727 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 46715010 46715100 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (369 nt):
ATGAAGCCTTCCATTGCCATCATTCTTTGCATCTTGATCCTGGGAGTTGACAGCCAAAGATGGGTCCAGT
TC
ATGAAAGAAGCTGGTCAAGGGTCTAGAGACATGTGGCGAGCCTACTCTGACATGAAGAAAGCTAACTG
G
AAAAACTCAGACAAATACTTCCATGCTCGGGGGAACTATGATGCTGCCCGGAGGGGTCCCGGGGGAGCC
TGG
GCTGCTAAAGTCATCAGCGATGCCAGAGAGGCTGTTCAGAAGTTCACGGGACATGGAGCAGAGGACT
CA
AGAGCTGACCAGTTTGCCAATGAGTGGGGCCGGAGTGGCAAAGACCCCAACCACTTCCGACCTGCTGG
C
CTGCCTAAAAGATACTGA


Translation (122 aa):
MKPSIAIILCILILGVDSQRWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGA
W
AAKVI
SDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser