NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Thursday, September 23, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS29727.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29727.1 Public Mus musculus 19 Slc1a1 23 108 98 CCDS HistoryNCBI Gene:20510Re-query CCDS DB by CCDS ID:29727.1See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29727.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000025875.4 ENSMUSP00000025875.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000025875.4Link to Ensembl Protein Viewer:ENSMUSP00000025875.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000025875Re-query CCDS DB by Protein ID:ENSMUSP00000025875
Original member Current member NCBI NM_009199.3 NP_033225.1 Accepted alive Link to Nucleotide Sequence:NM_009199.3Link to Protein Sequence:NP_033225.1Re-query CCDS DB by Nucleotide ID:NM_009199Re-query CCDS DB by Protein ID:NP_033225Link to BLAST:NP_033225.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033225.1 523 P51906 523 100% 0 0

Chromosomal Locations for CCDS 29727.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 28835242 28835332 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 28879013 28879153 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 28892835 28892927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 28894454 28894568 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 28896084 28896126 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 28897507 28897602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 28901442 28901626 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 28902686 28902793 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 28904612 28904734 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 28905333 28905527 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 28909431 28909565 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 28911654 28911900 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1572 nt):
ATGGGGAAGCCCACGAGCTCGGGATGTGACTGGCGCCGCTTCCTACGGAATCACTGGCTGCTGCTCTCCA
CC
GTGGCCGCCGTGGTACTAGGAATTGTCTTAGGAGTCGTGGTTCGAGGACACAGTGAGCTCTCAAATCT
G
GATAAATTCTACTTTGCTTTTCCTGGGGAAATTCTGATGAGGATGCTGAAGCTGGTCATTTTGCCGCTG
ATC
GTATCCAGCATGATCACAGGTGTCGCTGCACTGGATTCCAATGTGTCTGGGAAGATTGGTCTGCGCG
CT
GTAGTATATTATTTCTCCACCACCGTCATTGCTGTAATCCTAGGTATTGTGTTAGTTGTGAGTATCAA
G
CCTGGTGTCACTCAGAAAGTGAATGACATCAACAGGACGGGTAAAACCCCTGAAGTCAGCACCATGGAT
GCC
ATGTTGGACCTGATCAGGAACATGTTCCCTGAGAATCTGGTCCAAGCCTGTTTTCAGCAGTACAAAA
CC
AAGCGGGAAGAGGTGAAGCCTGTGGGCGATCCTGGGGGGAACGCAACGGAGGTGTCTGTCACCACAGC
C
ATGACAACAATGTCTGAGAACAAGACAAAGGAATACAAGATCGTGGGCCTGTACTCAGACGGCATCAAT
GTC
CTGGGCTTGATTATCTTCTGCCTCGTCTTTGGCCTTGTCATTGGGAAAATGGGAGAAAAGGGGCAGA
TT
CTGGTGGACTTCTTCAATGCCTTGAGTGACGCCACCATGAAAATCGTCCAGATCATCATGTGCTACAT
G
CCGATTGGCATTTTGTTCCTAATTGCTGGGAAGATCATAGAAGTTGAAGACTGGGAAATATTCCGCAAG
CTG
GGCCTTTACATGGCCACTGTCCTGAGCGGGCTTGCAATCCACTCCCTCATAGTTCTGCCCCTGCTCT
AT
TTCATAGTTGTGCGGAAGAACCCTTTCCGCTTTGCCTTGGGTATGGCGCAGGCTCTCCTGACAGCTCT
C
ATGATCTCGTCCAGTTCGGCAACCCTGCCAGTTACATTCCGCTGTGCGGAAGAAAAGAACCAGGTAGAC
AAG
AGGATCACGAGATTTGTGCTGCCTGTTGGTGCCACCATCAACATGGACGGCACTGCGCTCTACGAAG
CT
GTGGCAGCCGTGTTTATTGCGCAACTGAATGGCTTGGACCTAAGCATTGGGCAGATCGTCACCATCAG
C
ATTACAGCCACCGCTGCCAGCATTGGAGCTGCTGGGGTGCCCCAGGCTGGCCTGGTGACCATGGTGATC
GTG
CTGAGTGCTGTGGGGCTGCCTGCCGAGGACGTCACCCTGATCATTGCTGTTGACTGGCTCCTGGACC
GG
TTCAGGACCATGGTGAACGTCCTGGGTGATGCGTTTGGGACGGGCATCGTAGAGAAGCTCTCGAAGAA
G
GAGCTGGAGCAGATGGATGTTTCGTCTGAAGTCAACATCGTGAACCCCTTTGCCTTGGAACCCACAACC
CTC
GATAACGAAGACTCAGATACCAAGAAGTCTTATGTCAATGGGGGCTTCGCGGTAGACAAATCTGACA
CC
ATCTCGTTCACTCAGACCTCACAGTTCTAG


Translation (523 aa):
MGKPTSSGCDWRRFLRNHWLLLSTVAAVVLGIVLGVVVRGHSELSNLDKFYFAFPGEILMRMLKLVILPL
I
VSSMIT
GVAALDSNVSGKIGLRAVVYYFSTTVIAVILGIVLVVSIKPGVTQKVNDINRTGKTPEVSTMD
A
MLDLI
RNMFPENLVQACFQQYKTKREEVKPVGDPGGNATEVSVTTAMTTMSENKTKEYKIVGLYSDGIN
V
LGLIIFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIM
CYMPIGILFLIAGKIIEVEDWEIFRK
L
GLYMATVLS
GLAIHSLIVLPLLYFIVVRKNPFRFALGMAQALLTALMISSSSATLPVTFRCAEEKNQVD
K
RITRFVLPVGATINMDGTALYEAVAAVFIAQLNGLDLSIGQIVTI
SITATAASIGAAGVPQAGLVTMVI
V
LSAVGLPAEDVTLIIAVDWL
LDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNIVNPFALEPTT
L
DNEDSDTKKSYVNGGFAVDKSDTISFTQTSQF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser