NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS6712.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6712.1 Public Homo sapiens 9 FBP1 22 109 92 CCDS HistoryNCBI Gene:2203Re-query CCDS DB by CCDS ID:6712.1See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6712.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000375326.8 ENSP00000364475.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000375326.8Link to Ensembl Protein Viewer:ENSP00000364475.4Re-query CCDS DB by Nucleotide ID:ENST00000375326Re-query CCDS DB by Protein ID:ENSP00000364475
Original member Current member EBI ENST00000415431.5 ENSP00000408025.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000415431.5Link to Ensembl Protein Viewer:ENSP00000408025.1Re-query CCDS DB by Nucleotide ID:ENST00000415431Re-query CCDS DB by Protein ID:ENSP00000408025
Original member NCBI NM_000507.3 NP_000498.2 Updated not alive Link to Nucleotide Sequence:NM_000507.3Link to Protein Sequence:NP_000498.2Re-query CCDS DB by Nucleotide ID:NM_000507Re-query CCDS DB by Protein ID:NP_000498
Current member NCBI NM_000507.4 NP_000498.2 Accepted alive Link to Nucleotide Sequence:NM_000507.4Link to Protein Sequence:NP_000498.2Re-query CCDS DB by Nucleotide ID:NM_000507Re-query CCDS DB by Protein ID:NP_000498Link to BLAST:NP_000498.2
Original member NCBI NM_001127628.1 NP_001121100.1 Updated not alive Link to Nucleotide Sequence:NM_001127628.1Link to Protein Sequence:NP_001121100.1Re-query CCDS DB by Nucleotide ID:NM_001127628Re-query CCDS DB by Protein ID:NP_001121100
Current member NCBI NM_001127628.2 NP_001121100.1 Accepted alive Link to Nucleotide Sequence:NM_001127628.2Link to Protein Sequence:NP_001121100.1Re-query CCDS DB by Nucleotide ID:NM_001127628Re-query CCDS DB by Protein ID:NP_001121100Link to BLAST:NP_001121100.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000498.2 338 P09467 338 100% 0 0
NP_001121100.1 338 P09467 338 100% 0 0

Chromosomal Locations for CCDS 6712.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 94603381 94603572 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 94605457 94605576 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 94606815 94606952 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 94609921 94610061 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 94617768 94617860 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 94620329 94620491 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 94639141 94639310 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1017 nt):
ATGGCTGACCAGGCGCCCTTCGACACGGACGTCAACACCCTGACCCGCTTCGTCATGGAGGAGGGCAGGA
AG
GCCCGCGGCACGGGCGAGTTGACCCAGCTGCTCAACTCGCTCTGCACAGCAGTCAAAGCCATCTCTTC
G
GCGGTGCGCAAGGCGGGCATCGCGCACCTCTATGGCATTGCTGGTTCTACCAACGTGACAGGTGATCAA
GTT
AAGAAGCTGGACGTCCTCTCCAACGACCTGGTTATGAACATGTTAAAGTCATCCTTTGCCACGTGTG
TT
CTCGTGTCAGAAGAAGATAAACACGCCATCATAGTGGAACCGGAGAAAAGGGGTAAATATGTGGTCTG
T
TTTGATCCCCTTGATGGATCTTCCAACATCGATTGCCTTGTGTCCGTTGGAACCATTTTTGGCATCTAT
AGA
AAGAAATCAACTGATGAGCCTTCTGAGAAGGATGCTCTGCAACCAGGCCGGAACCTGGTGGCAGCCG
GC
TACGCACTGTATGGCAGTGCCACCATGCTGGTCCTTGCCATGGACTGTGGGGTCAACTGCTTCATGCT
G
GACCCGGCCATCGGGGAGTTCATTTTGGTGGACAAGGATGTGAAGATAAAAAAGAAAGGTAAAATCTAC
AGC
CTTAACGAGGGCTACGCCAGGGACTTTGACCCTGCCGTCACTGAGTACATCCAGAGGAAGAAGTTCC
CC
CCAGATAATTCAGCTCCTTATGGGGCCCGGTATGTGGGCTCCATGGTGGCTGATGTTCATCGCACTCT
G
GTCTACGGAGGGATATTTCTGTACCCCGCTAACAAGAAGAGCCCCAATGGAAAGCTGAGACTGCTGTAC
GAA
TGCAACCCCATGGCCTACGTCATGGAGAAGGCTGGGGGAATGGCCACCACTGGGAAGGAGGCCGTGT
TA
GACGTCATTCCCACAGACATTCACCAGAGGGCGCCGGTGATCTTGGGATCCCCCGACGACGTGCTCGA
G
TTCCTGAAGGTGTATGAGAAGCACTCTGCCCAGTGA


Translation (338 aa):
MADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQ
V
KKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKR
GKYVVCFDPLDGSSNIDCLVSVGTIFGIY
R
K
KSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIY
S
LNEGYARDFDPAVTEYIQRKKFPP
DNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLY
E
CNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser