NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS21732.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21732.1 Public Mus musculus 7 Tub 21 106 86 CCDS HistoryNCBI Gene:22141Re-query CCDS DB by CCDS ID:21732.1See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21732.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033341 ENSMUSP00000033341 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033341Link to Ensembl Protein Viewer:ENSMUSP00000033341Re-query CCDS DB by Nucleotide ID:ENSMUST00000033341Re-query CCDS DB by Protein ID:ENSMUSP00000033341
Original member Current member EBI,WTSI OTTMUST00000074987 OTTMUSP00000039234 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000074987Link to Vega Protein Viewer:OTTMUSP00000039234Re-query CCDS DB by Nucleotide ID:OTTMUST00000074987Re-query CCDS DB by Protein ID:OTTMUSP00000039234
Original member Current member NCBI NM_021885.4 NP_068685.1 Accepted alive Link to Nucleotide Sequence:NM_021885.4Link to Protein Sequence:NP_068685.1Re-query CCDS DB by Nucleotide ID:NM_021885Re-query CCDS DB by Protein ID:NP_068685Link to BLAST:NP_068685.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_068685.1 505 P50586-1 505 100% 0 0

Chromosomal Locations for CCDS 21732.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 109011101 109011138 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 109020517 109020568 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 109020867 109021029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 109022610 109022753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 109024490 109024657 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 109025608 109025726 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 109026590 109026787 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 109027003 109027115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 109027753 109027870 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 109029262 109029360 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 109029554 109029725 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 109030124 109030257 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1518 nt):
ATGACTTCCAAGCCGCATTCCGACTGGATTCCTTACAGTGTCCTAGATGATGAGGGCAGCAACCTGAGGC
AG
CAGAAGCTCGACCGGCAGCGGGCCCTGTTGGAACAGAAGCAGAAGAAGAAGCGCCAAGAGCCCTTGAT
G
GTACAGGCCAATGCAGATGGACGGCCCCGGAGTCGGCGAGCCCGGCAGTCAGAGGAGCAAGCCCCCCTG
GTG
GAGTCCTACCTCAGCAGCAGTGGCAGCACCAGCTACCAAGTTCAAGAGGCCGACTCGATTGCCAGTG
TA
CAGCTGGGAGCCACCCGCCCACCAGCACCAGCCTCAGCCAAGAAATCCAAGGGAGCGGCTGCATCTGG
G
GGCCAGGGTGGAGCCCCTAGGAAGGAGAAGAAGGGAAAGCATAAAGGCACCAGCGGGCCAGCAACTCTG
GCA
GAAGACAAGTCTGAGGCCCAAGGCCCAGTGCAGATCTTGACTGTGGGACAGTCAGACCACGACAAGG
AT
GCGGGAGAGACAGCAGCCGGCGGGGGCGCACAGCCCAGTGGGCAGGACCTCCGTGCCACGATGCAGAG
G
AAGGGCATCTCCAGCAGCATGAGCTTTGACGAGGACGAGGATGAGGATGAAAACAGCTCCAGCTCCTCC
CAG
CTAAACAGCAACACCCGCCCTAGTTCTGCCACTAGCAGAAAGTCCATCCGGGAGGCAGCTTCAGCCC
CC
AGCCCAGCCGCCCCAGAGCCACCAGTGGATATTGAGGTCCAGGATCTAGAGGAGTTTGCACTGAGGCC
A
GCCCCACAAGGGATCACCATCAAATGCCGCATCACTCGGGACAAGAAGGGGATGGACCGCGGCATGTAC
CCC
ACCTACTTTCTGCACCTAGACCGTGAGGATGGCAAGAAGGTGTTCCTCCTGGCGGGCAGGAAGAGAA
AG
AAGAGTAAAACTTCCAATTACCTCATCTCTGTGGACCCAACAGACTTGTCTCGGGGAGGCGATAGCTA
T
ATCGGGAAATTGCGGTCCAACCTGATGGGCACCAAGTTCACCGTTTATGACAATGGCGTCAACCCTCAG
AAG
GCATCCTCTTCCACGCTGGAAAGCGGAACCTTGCGCCAGGAGCTGGCAGCGGTGTGCTATGAGACAA
AT
GTCCTAGGCTTCAAGGGACCTCGGAAGATGAGTGTGATCGTCCCAGGCATGAACATGGTTCATGAGAG
A
GTCTGTATCCGCCCCCGCAATGAACATGAGACCCTGTTAGCACGCTGGCAGAACAAGAACACGGAGAGC
ATC
ATTGAGCTGCAGAACAAGACGCCAGTCTGGAATGATGACACACAGTCCTATGTACTTAACTTCCACG
GC
CGTGTCACACAGGCTTCTGTGAAGAACTTCCAGATCATCCACGGCAATGACCCGGACTACATCGTCAT
G
CAGTTTGGCCGGGTAGCAGAAGATGTGTTCACCATGGATTACAACTACCCACTGTGTGCACTGCAGGCC
TTT
GCCATTGCTCTGTCCAGCTTTGACAGCAAGCTGGCCTGCGAGTAG


Translation (505 aa):
MTSKPHSDWIPYSVLDDEGSNLRQQKLDRQRALLEQKQKKKRQEPLMVQANADGRPRSRRARQSEEQAPL
V
ESYLSSSGSTSYQ
VQEADSIASVQLGATRPPAPASAKKSKGAAASGGQGGAPRKEKKGKHKGTSGPATL
A
EDKSEAQGPVQILTVGQSDHDKDAGETAAGGGAQPSGQDLRATMQRK
GISSSMSFDEDEDEDENSSSSS
Q
LNSNTRPSSATSRKSIR
EAASAPSPAAPEPPVDIEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMY
P
TYFLHLDREDGKK
VFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQ
K
ASSSTLESGTLRQELAAVCY
ETNVLGFKGPRKMSVIVPGMNMVHERVCIRPRNEHETLLARWQNKNTES
I
IELQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGND
PDYIVMQFGRVAEDVFTMDYNYPLCALQA
F
AIALSSFDSKLACE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser