NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS18219.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18219.1 Public Mus musculus 4 Ugcg 23 108 98 CCDS HistoryNCBI Gene:22234Re-query CCDS DB by CCDS ID:18219.1See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 18219.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000030074.7 ENSMUSP00000030074.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000030074.7Link to Ensembl Protein Viewer:ENSMUSP00000030074.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000030074Re-query CCDS DB by Protein ID:ENSMUSP00000030074
Original member Current member NCBI NM_011673.3 NP_035803.1 Accepted alive Link to Nucleotide Sequence:NM_011673.3Link to Protein Sequence:NP_035803.1Re-query CCDS DB by Nucleotide ID:NM_011673Re-query CCDS DB by Protein ID:NP_035803Link to BLAST:NP_035803.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035803.1 394 O88693 394 100% 0 0

Chromosomal Locations for CCDS 18219.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 59189644 59189741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59207761 59207902 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59211876 59211978 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59213159 59213260 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59213865 59213977 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59217036 59217214 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59218495 59218581 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59219489 59219678 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59220223 59220393 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1185 nt):
ATGGCGCTGCTGGACCTGGCCCAGGAGGGAATGGCCTTGTTCGGCTTCGTGCTCTTCGTGGTGCTGTGGC
TG
ATGCATTTCATGTCCATCATCTACACCCGGTTACACCTCAACAAGAAGGCAACAGACAAACAGCCGTA
T
AGCAAGCTCCCTGGTGTCTCTCTTCTGAAGCCACTGAAGGGGGTGGATCCTAACCTAATCAACAACTTG
GAG
ACATTCTTTGAACTGGATTATCCCAAATATGAAGTACTCCTTTGTGTACAAGATCATGATGATCCAG
CC
ATTGATGTATGTAAGAAATTGCTTGGAAAATACCCAAATGTCGATGCTAGATTATTTATAGGTGGCAA
A
AAGGTTGGCATTAACCCTAAAATTAATAATTTGATGCCAGCATATGAAGTTGCAAAATATGATCTCATA
TGG
ATTTGTGATAGTGGAATAAGAGTCATCCCAGACACATTAACTGACATGGTGAATCAGATGACAGAGA
AA
GTGGGGTTGGTCCACGGGCTGCCGTATGTAGCCGACAGACAAGGCTTTGCTGCCACCTTAGAGCAGGT
A
TATTTTGGAACTTCACACCCAAGATCCTATATCTCTGCCAATGTAACTGGCTTCAAATGTGTGACGGGG
ATG
TCTTGTTTGATGAGGAAGGATGTGCTAGATCAGGCAGGAGGGCTCATAGCCTTTGCTCAGTACATTG
CT
GAAGATTACTTTATGGCCAAAGCAATAGCCGACCGAGGTTGGAGGTTTTCAATGTCTACTCAAGTTGC
C
ATGCAAAACTCTGGTTCGTACTCAATTTCTCAGTTTCAATCCAGAATGATCAGGTGGACCAAATTGAGA
ATT
AACATGCTTCCTGCTACAATAATTTGTGAGCCAATTTCAGAATGCTTTGTTGCCAGTTTAATTATTG
GG
TGGGCAGCCCACCATGTATTCAGATGGGATATCATGGTCTTCTTCATGTGCCACTGCCTGGCATGGTT
T
ATATTTGACTACATTCAACTCAGGGGTGTCCAGGGTGGCACACTGTGTTTTTCAAAACTTGATTATGCT
GTG
GCCTGGTTCATCCGTGAATCCATGACAATCTACATTTTCCTGTCGGCATTATGGGACCCGACTATAA
GC
TGGAGAACTGGTCGCTACAGGTTACGCTGTGGGGGGACAGCAGAGGAGATCCTGGATGTGTAA


Translation (394 aa):
MALLDLAQEGMALFGFVLFVVLWLMHFMSIIYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNL
E
TFFELDYPK
YEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPAYEVAKYDLI
W
ICDSGIR
VIPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRSYISANVTGFKCVTG
M
SCLMRKDVLDQAGGLIAFAQYIAEDYFMAKAIAD
RGWRFSMSTQVAMQNSGSYSISQFQSRMIRWTKLR
I
NMLPATIICEPISECFVASLIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQ
GGTLCFSKLDYA
V
AWFIRESMTIYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser