NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS16048.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16048.1 Public Mus musculus 2 Cytip 23 108 98 CCDS HistoryNCBI Gene:227929Re-query CCDS DB by CCDS ID:16048.1See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16048.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000028175.6 ENSMUSP00000028175.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028175.6Link to Ensembl Protein Viewer:ENSMUSP00000028175.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000028175Re-query CCDS DB by Protein ID:ENSMUSP00000028175
Original member Current member NCBI NM_139200.4 NP_631939.1 Accepted alive Link to Nucleotide Sequence:NM_139200.4Link to Protein Sequence:NP_631939.1Re-query CCDS DB by Nucleotide ID:NM_139200Re-query CCDS DB by Protein ID:NP_631939Link to BLAST:NP_631939.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_631939.1 359 Q91VY6 359 100% 0 0

Chromosomal Locations for CCDS 16048.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 58133727 58134193 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58137859 58137925 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58145137 58145206 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58147875 58147968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58148166 58148268 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58151114 58151168 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58151714 58151763 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 58159882 58160055 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1080 nt):
ATGTCTCTGCAAAGGTTTCTGCAGCGGCAGGGCAGCAATGGCAATTTGGAGTACTGTGCTGACTCTGCCT
AC
GGCTCCTACTCCGTCCTCACGGGCCAGCTCACGATGGAAGACAACCGAAGGATTCAAGTGCTGGCAGA
C
ACTGTAGCTACTTTGCCCCGGGGACGAAAGCAGCTTGCGTTGGCCAGATCAAGCTCTTTGGGTGATTTT
TCC
TGGTCTCAAAGGAAGGTTGTTACTGTGGAAAAGCAGGACAATGGAACATTTGGATTTGAAATTCAGA
CC
TACAGACTCCAGAACCAGAACATCTGTTCCTCAGAAGTGTGCACTATGATCTGCAAAGTGCAGGAAGA
C
AGCCCCGCTCACTGTGCTGGCCTGCAAGTTGGTGACATCTTTGCAAATGTCAATGGTGTGAGCACAGAA
GGC
TTTACTCACAAACAAGTGGTTGACCTGATCCGATCATCAGGAAATCTGCTAACGATAGAGACTCTTA
AT
GGAACAATGATTCACAGAAGAGCAGAACTTGAAGCAAAACTGCAGACTTTAAAGCAAACCTTGAAGAA
A
AAATGGGTGGAGCTCAGGTCTCTGCACTTACAGGAACAGCGCCTGTTGCATGGAGACACAGCAAACTCC
CCA
AATTTGGAAAACATGGACCTCGACGAGTCGTCCTTGTTTGGAAATCTGCTGGGGCCGAGTCCAGCCC
TC
CTGGACCGGCATCGACTGTCCAGTGAGAGCAGTTGTAAGAGTTGGCTGAGCTCCCTCACAGTGGACAG
T
GAGGACGGCTACCGGAGCAGTATGTCTGAGGACTCCATCCGGGGTGCCTTCAGCCGGCAGACCAGCACC
GAC
GATGAGTGCTTTCACTCTAAGGATGGAGACGAGATTCTGCGGAATGCTTCTTCCAGGAGAAACCGGA
GC
ATCAGTGTCACTAGTAGTGGGTCCTTTTCTCCCTTGTGGGAGAGCAATTACTCAAGCGTGTTTGGGAC
C
CTGCCCCGGAAAAGCAGACGGGGTAGTGTCCGGAAACAAATTTTGAAATTCATCCCTGGCCTTCATCGT
GCA
GTGGAAGAGGAAGAGAGTCGCTTTTGA


Translation (359 aa):
MSLQRFLQRQGSNGNLEYCADSAYGSYSVLTGQLTMEDNRRIQVLADTVATLPRGRKQLALARSSSLGDF
S
WSQ
RKVVTVEKQDNGTFGFEIQTYRLQNQNICSSEVCTMICKVQEDSPAHCAGLQVGDIFANVNGVSTE
G
FTHKQVVDLIRSSGNLL
TIETLNGTMIHRRAELEAKLQTLKQTLKKKWVELRSLHLQEQRLLHGDTANS
P
NLENMDLDESSLFGNLLGPSPALLDRHRLSSESSCKSWLSSLTVDSEDGYRSSMSEDSIRGAFSRQTST
D
DECFHSKDGDEILRNASSRRNRSISVTSSGSFSPLWESNYSSVFGTLPRKSRRGSVRKQILKFIPGLHR
A
VEEEESRF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser