NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS19619.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19619.1 Public Mus musculus 5 Sds 23 108 98 CCDS HistoryNCBI Gene:231691Re-query CCDS DB by CCDS ID:19619.1See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 19619.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000066540.13 ENSMUSP00000064849.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000066540.13Link to Ensembl Protein Viewer:ENSMUSP00000064849.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000066540Re-query CCDS DB by Protein ID:ENSMUSP00000064849
Original member Current member EBI ENSMUST00000201684.3 ENSMUSP00000143838.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000201684.3Link to Ensembl Protein Viewer:ENSMUSP00000143838.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000201684Re-query CCDS DB by Protein ID:ENSMUSP00000143838
Original member Current member NCBI NM_145565.1 NP_663540.1 Accepted alive Link to Nucleotide Sequence:NM_145565.1Link to Protein Sequence:NP_663540.1Re-query CCDS DB by Nucleotide ID:NM_145565Re-query CCDS DB by Protein ID:NP_663540Link to BLAST:NP_663540.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_663540.1 327 Q8VBT2 327 100% 0 0

Chromosomal Locations for CCDS 19619.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 120479081 120479233 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120480312 120480351 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120480576 120480715 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120480807 120480898 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120481453 120481680 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120483064 120483188 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120483573 120483778 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (984 nt):
ATGGCTGCCCAGGAGTCCCTGCATGTGAAGACCCCACTTCGTGACAGCATGGCGTTGTCCAAATTGGCCG
GC
ACCAGCGTGTTCCTAAAAATGGACAGCTCCCAGCCCTCAGGCTCCTTCAAGATCCGAGGCATTGGGCA
T
CTCTGCAAGATGAAAGCAAAACAAGGCTGTAGACATTTTGTCTGTTCTTCAGCTGGCAACGCGGGCATG
GCG
ACCGCCTACGCTGCCAGGAGGCTGGGCATCCCAGCCACTATCGTTGTGCCCAACACCACACCTGCCC
TC
ACCATTGAGCGGCTCAAGAATGAAGGCGCCACAGTTGAAGTGGTGGGAGAGATGCTGGATGAGGCCAT
C
CAAGTGGCCAAGGCTCTGGAAAAGAACAACCCGGGTTGGGTGTACATTTCCCCCTTTGATGACCCTCTC
ATC
TGGGAAGGCCACACTTCCCTTGTGAAAGAGCTGAAGGAGACGCTGAGCGCCAAGCCCGGGGCTATCG
TG
CTGTCTGTGGGCGGTGGAGGCCTGCTGTGCGGAGTGGTCCAGGGGCTGCGGGAGGTGGGCTGGGAGGA
T
GTGCCCATCATCGCCATGGAGACCTTTGGCGCCCACAGCTTCCATGCTGCCATCAAGGAAGGAAAGCTG
GTC
ACCCTGCCCAAGATCACCAGTGTCGCCAAGGCCTTGGGCGTGAACACTGTCGGGGCGCAGACCCTGA
AG
CTGTTTTACGAACACCCCATTTTCTCCGAGGTCATCTCAGACCAGGAGGCTGTGTCTGCTCTTGAGAA
G
TTCGTGGACGATGAGAAGATTCTGGTGGAGCCCGCGTGCGGCGCGGCGCTGGCTGCTGTGTACAGCCGC
GTG
GTGTGCAGGCTGCAGGATGAAGGCCGGCTGCAAACCCCACTGGCCTCGCTGGTTGTCATCGTGTGTG
GC
GGCAGCAACATAAGCCTGGCGCAGCTGCAGGCACTCAAGGTGCAGCTGGGCCTGAACGGGCTGCCCGA
G
TGA


Translation (327 aa):
MAAQESLHVKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHFVCSSAGNAGM
A
TAYAARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGE
MLDEAIQVAKALEKNNPGWVYISPFDDPL
I
WEGHTSLVKELKETLSAKPGAIVLSVGGGGLLCGVVQGLREVGWEDVPIIAMETFGAHSFHAAIKEGKL
V
TLPKIT
SVAKALGVNTVGAQTLKLFYEHPIFSEVISDQEAVSALEKFVDDEKILVEPACGAALAAVYSR
V
VCRLQDEGRLQTPLASLVVIVCGGSNISLAQLQALKVQLGLNGLPE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser