NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS20681.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
20681.1 Public Mus musculus 6 Pyroxd1 23 108 98 CCDS HistoryNCBI Gene:232491Re-query CCDS DB by CCDS ID:20681.1See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 20681.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000041852.7 ENSMUSP00000036394.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000041852.7Link to Ensembl Protein Viewer:ENSMUSP00000036394.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000041852Re-query CCDS DB by Protein ID:ENSMUSP00000036394
Original member Current member NCBI NM_183165.3 NP_898988.2 Accepted alive Link to Nucleotide Sequence:NM_183165.3Link to Protein Sequence:NP_898988.2Re-query CCDS DB by Nucleotide ID:NM_183165Re-query CCDS DB by Protein ID:NP_898988Link to BLAST:NP_898988.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_898988.2 498 Q3TMV7 498 100% 0 0

Chromosomal Locations for CCDS 20681.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 142345733 142345807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142347558 142347638 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142348523 142348642 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142351062 142351190 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142353525 142353598 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142354625 142354785 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142356483 142356583 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142357380 142357512 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142358399 142358511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142359036 142359158 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142360859 142360996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142361754 142362002 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1497 nt):
ATGGAGGCCCCGCGACCGGCAGGGACATTCGTGGTGGTAGGAGGTGGCATCGCTGGCGTCACGTGTGCCG
AG
CAGCTGGCTGTCAGTTTCCCAGAGGAAGACATTCTCCTAGTCACAGCCTCTCCTGTTATCAAAGCCGT
T
ACAAACTTCAGACAGGTTTCTAAAGTACTGGAAGAATTTGATGTTGAAGAACAGCCAGGTACTATGCTG
GAA
AGTCGCTTTCCCAACATTAAGGTCATCGAATCTGGAGTAAAGCAGTTGAAAAGTGAAGACCATTGCA
TC
TTCACAGAAGACGGTCGTGAATTTGTATATAAGAAACTCTGTCTGTGTGCTGGAGCTAAGCCAAAGTT
A
ATCTACGAGGGAAATCCACGTGTACTGGGAATCCGTGATACAGACAGTGCTCAGGAATTTCAGAAAGAG
CTT
GCAAAAGCCAGGAGGATAATGATTGTCGGGAATGGTGGCATTGCTCTGGAGCTAGCGTATGAAATTG
AA
GGCTGTGAAGTAGTTTGGGCCATAAAGGATAACGCCATTGGGAATACATTCTTTGACGCGGGTGCAGC
A
GAGTTTCTGACTTCCAAGCTCATGTCTGAAAAATCAGAGGCTAAAATTGCACATAAAAGAACTATATAT
ACA
GTTGAAGAAGCAAAGAAGGAAACCAGAACCAAATCTAAAGCTGATTATGTGGGCAGTGCCCTTGGAC
CA
GACTGGCACGGAGGCTTGGCTTTGAAAGGAACTGAAGAGTTTTCTCACAGTGTTCACATTGAAACCAG
A
TGTGAAGTAAAGAAAATCTACCTTGAAGAGGAATTTAAGATTATGAAGAAAAAGTCCTTGGCTTTTCCA
AAG
GACCACCATAAGTCAGTTACAGCTGATAAAGAAATGTGGCCTGTGTATGTGGAACTGACCAATGGGA
CA
ATATACGGCTGTGATTTCCTTGTCAGCGCTACAGGAGTCACCCCAAACGTACACCCTTTTCTTCATAG
A
AACAATTTTGCTCTAGGAGAAGATGGCGGCCTGAGAGTGGATGACCAGATGCGCACGTCACTTCCTGAT
ATC
TATGCTGCTGGAGACATCTGCACTGCGTGCTGGCAGCCGAGTCCAGTCTGGCAGCAGATGAGGTTGT
GG
ACACAGGCCCGGCAGATGGGGTATTATGCAGCCAAGTGCATGGCCGCAGCTAGCATGGGACATCCTAT
T
GACATGGATTTCAGCTTTGAACTGTTTGCTCATGTCACAAAGTTTTTTAACTATAAGGTTGTATTGCTG
GGA
AAATACAACGCACAAGGCCTGGGCGCAGACCATGAGTTGATGCTGAGGTGCACCAGAGGACAAGAGT
AT
GTCAAAGTCGTTATGCAGAATGGACGCATGATGGGAGCCGTCTTAATTGGTGAAACGGACTTAGAGGA
A
ACATTTGAAAATTTAATCTTAAACCAAATGGACCTTTCATCATACGGGGAGGATCTCCTAGATCCAAAT
ATC
GACATAGAGGATTATTTTGATTGA


Translation (498 aa):
MEAPRPAGTFVVVGGGIAGVTCAEQLAVSFPEEDILLVTASPVIKAVTNFRQVSKVLEEFDVEEQPGTML
E
SRFPNIKVIESGVKQLKSEDH
CIFTEDGREFVYKKLCLCAGAKPKLIYEGNPRVLGIRDTDSAQEFQKE
L
AKARRIMIVGNGGIALEL
AYEIEGCEVVWAIKDNAIGNTFFDAGAAEFLTSKLMSEKSEAKIAHKRTIY
T
VE
EAKKETRTKSKADYVGSALGPDWHGGLALKGTEEFSHSVHIETRCEVKKIYLEEEFKIMKKKSLAFP
K
DHHKSVTADK
EMWPVYVELTNGTIYGCDFLVSATGVTPNVHPFLHRNNFALGEDGGLRVDDQMRTSLPD
I
YAAGDICTACWQPSPVWQQ
MRLWTQARQMGYYAAKCMAAASMGHPIDMDFSFELFAHVTKFFNYKVVLL
G
KYNAQGLGADHELMLRCTRGQEYVKVVMQNGRMMGAVLIGETDLEETFENLILNQMDLSSYGEDLLDPN
I
DIEDYFD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser