NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS39239.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39239.1 Public Mus musculus 5 Tpcn1 23 108 98 CCDS HistoryNCBI Gene:252972Re-query CCDS DB by CCDS ID:39239.1See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 39239.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000046426.9 ENSMUSP00000042188.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000046426.9Link to Ensembl Protein Viewer:ENSMUSP00000042188.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000046426Re-query CCDS DB by Protein ID:ENSMUSP00000042188
Original member Current member NCBI NM_145853.2 NP_665852.1 Accepted alive Link to Nucleotide Sequence:NM_145853.2Link to Protein Sequence:NP_665852.1Re-query CCDS DB by Nucleotide ID:NM_145853Re-query CCDS DB by Protein ID:NP_665852Link to BLAST:NP_665852.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_665852.1 817 Q9EQJ0-1 817 100% 0 0

Chromosomal Locations for CCDS 39239.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 120536108 120536224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120537561 120537641 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120537812 120537951 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120539003 120539087 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120539210 120539278 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120539789 120539835 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120540574 120540689 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120541878 120541967 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120542455 120542526 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120543345 120543452 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120544413 120544485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120545075 120545128 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120545258 120545314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120547449 120547493 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120547935 120547998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120548271 120548319 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120549491 120549615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120549926 120550042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120553443 120553542 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120553753 120553811 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120554276 120554310 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120555133 120555221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120555868 120555998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120556472 120556585 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120557770 120557946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120560216 120560343 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120585185 120585296 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2454 nt):
ATGGCTGTAAGTTTAGATGACGATGTGCCGCTCATCCTGACCTTGGACGAGGCTGAGAGTGCTCCGCTGC
CT
CCTTCGAACAGCCTGGGCCAAGAGCAGCTGCCCAGCAAAAATGGGGGCAGCCACAGCATCCACAACTC
C
CAGGTCCCCAGTCTGGTCTCCGGAGCGGACAGCCCCCCCTCCAGTCCCACCGGACACAACTGGGAGATG
AAT
TATCAAGAGGCGGCAATCTACCTCCAGGAAGGTCAGAACAACGACAAGTTCTTCACCCACCCCAAGG
AT
GCCAGAGCGCTGGCGGCCTACCTCTTCGTCCACAACCACTTCTTCTACATGATGGAGCTGCTCACGGC
C
CTGCTCCTGCTGCTGCTGTCGCTGTGCGAGTCCCCCGCTGTCCCCGTGCTCAAGCTGCACACTTACGTC
CAC
GCCACGCTGGAACTCTTTGCCCTCATGGTGGTGGTATTTGAACTCTGCATGAAATTGCGGTGGCTGG
GC
TTCCACACGTTCGTCCGGCACAAACGTACCATGGTCAAGACGTCCGTCCTCGTGGTGCAGTTCATCGA
G
GCCATTGTGGTGCTGGTTCGGCAGACGTCCCACGTGCGGGTGACCCGGGCACTACGCTGCATTTTCCTG
GTG
GACTGTCGCTACTGTGGCGGTGTACGGCGCAACCTGCGGCAGATCTTCCAGTCTCTCCCACCCTTCA
TG
GACATCCTCCTGTTGCTGCTCTTCTTTATGATCATCTTTGCCATCCTCGGTTTCTACTTATTCTCCAC
A
AATCCTTCCGACCCCTACTTCAGCACCCTGGAGAACAGCATCGTCAACCTGTTCGTTCTCCTGACCACA
GCC
AACTTTCCAGATGTCATGATGCCCTCCTACTCCCGGAACCCCTGGTCCTGCGTCTTCTTCATTGTAT
AC
CTCTCCATTGAGCTGTACTTCATCATGAACCTGCTCCTGGCCGTGGTGTTCGACACCTTCAACGACAT
T
GAAAAGCACAAGTTCAAGTCTTTGCTGCTGCACAAACGGACCGCCATCCAGCATGCCTACGGCCTGCTT
GCC
AGCCAACGGAGGCCGGCTGGCATCTCCTACAGGCAGTTCGAAGGCTTAATGCGCTTCTACAAGCCCC
GG
ATGAGTGCAAGGGAACGCTTCCTGACTTTCAAGGCCTTGAACCAGAGCAACACGCCTCTGCTCAGCCT
G
AAGGACTTCTATGATATTTACGAAGTCGCTGCTCTGCAGTGGAAGGCAAAGAGAAACAGACAGCATTGG
TTT
GATGAGCTCCCCCGGACAGCCTTCCTCATCTTCAAAGGGATTAACATCCTTGTGAATTCCAAGGCCT
TC
CAGTATTTCATGTACTTGGTGGTGGCTGTCAACGGTGTCTGGATCCTGGTGGAGACATTCATGTTGAA
A
GGTGGGAATTTCACCTCAAAGCATGTGCCCTGGAGTTACCTCGTGTTTCTTACCATCTATGGAGTTGAA
CTG
TTCATGAAGGTGGCTGGCCTGGGCCCTGTGGAGTACCTGTCCTCTGGATGGAACCTGTTCGATTTCT
CG
GTCACGGCATTCGCCTTCCTGGGACTGCTCGCACTGACGCTCAACATGGAACCCTTCTATTTCATTGT
G
GTCCTGCGTCCCCTTCAGCTGCTGAGGTTATTTAAACTGAAGAAACGCTACCGCAACGTGTTGGACACC
ATG
TTTGAGCTGCTGCCGCGGATGGCCAGCCTTGGCCTCACGCTGCTCACCTTCTACTATTCCTTCGCCA
TC
GTGGGCATGGAGTTCTTCAACGGGCGGCTGACCCCCAACTGCTGCAACACCAGCACAGTGGCCGACGC
C
TACCGGTTCATCAACCACACTGTGGGCAATAAGACCAAGGTAGAGGAAGGCTACTACTATCTCAACAAC
TTT
GACAACATCCTCAACAGCTTCGTGACCTTGTTTGAGCTCACCGTTGTCAACAATTGGTACATCATCA
TG
GAAGGCGTCACCTCGCAGACGTCCCACTGGAGCCGCCTGTACTTCATGACCTTTTACATAGTGACCAT
G
GTGGTGATGACCATTATCGTGGCCTTCATCCTGGAGGCCTTCGTCTTCCGCATGAACTACAGCCGCAAG
AGC
CAGGACTCGGAAGTGGACAGTGGCATCGTCATCGAGAAGGAAATGTCCAAGGAGGAGCTTATGGCCG
TC
CTGGAGCTTTATCGTGAGGAGCGAGGCACCTCCTCTGACGTGACCCGGCTGCTGGACACCCTCTCTCA
G
ATGGAGAAATACCAGCAAAATTCCATGGTGTTTCTGGGACGGCGATCGAGAACCAAAAGTGACCTGAGT
CTG
AAGATGTACCAGGAGGAGATCCAGGAGTGGTACGAGGAGCATGCCCGGGAACAGGAGCAGCAGAAGC
TC
AGGGGCAGCGTGCCCGGCCCTGCAGCCCAGCAGCCCCCTGGCAGTCGCCAGCGCTCCCAGACTGTCAC
C
TAG


Translation (817 aa):
MAVSLDDDVPLILTLDEAESAPLPPSNSLGQEQLPSKNGGSHSIHNSQVPSLVSGADSPPSSPTGHNWEM
N
YQEAAIYLQ
EGQNNDKFFTHPKDARALAAYLFVHNHFFYMMELLTALLLLLLSLCESPAVPVLKLHTYV
H
ATLELFALMVVVFELCMKLRWLGFHTFVRHKRTMVK
TSVLVVQFIEAIVVLVRQTSHVRVTRALRCIFL
V
DCRYCGGVR
RNLRQIFQSLPPFMDILLLLLFFMIIFAILGFYLFSTNPSDPYFSTLENSIVNLFVLLTT
A
NFPDVMMPSYSRNPWSCVFFIVYLSIELYFIMNLLLAVVFDTFNDIEKHKFKSLLLHKRTAIQHAYGLL
A
SQR
RPAGISYRQFEGLMRFYKPRMSARERFLTFKALNQSNTPLLSLKDFYDIYEVAALQWKAKRNRQHW
F
DELPRTAFLIFK
GINILVNSKAFQYFMYLVVAVNGVWILVETFMLKGGNFTSKHVPWSYLVFLTIYGVE
L
FMKVAGLGPVEYLSSGWN
LFDFSVTAFAFLGLLALTLNMEPFYFIVVLRPLQLLRLFKLKKRYRNVLDT
M
FELLPRMA
SLGLTLLTFYYSFAIVGMEFFNGRLTPNCCNTSTVADAYRFINHTVGNKTKVEEGYYYLNN
F
DNILNSF
VTLFELTVVNNWYIIMEGVTSQTSHWSRLYFMTFYIVTMVVMTIIVAFILEAFVFRMNYSRK
S
QDSE
VDSGIVIEKEMSKEELMAVLELYREERGTSSDVTRLLDTLSQMEKYQQNSMVFLGRRSRTKSDLS
L
KMYQEEIQ
EWYEEHAREQEQQKLRGSVPGPAAQQPPGSRQRSQTVT



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser