NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27948.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27948.1 Public Mus musculus 16 Nubp1 23 108 98 CCDS HistoryNCBI Gene:26425Re-query CCDS DB by CCDS ID:27948.1See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27948.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000023146.4 ENSMUSP00000023146.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023146.4Link to Ensembl Protein Viewer:ENSMUSP00000023146.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000023146Re-query CCDS DB by Protein ID:ENSMUSP00000023146
Original member Current member NCBI NM_011955.2 NP_036085.1 Accepted alive Link to Nucleotide Sequence:NM_011955.2Link to Protein Sequence:NP_036085.1Re-query CCDS DB by Nucleotide ID:NM_011955Re-query CCDS DB by Protein ID:NP_036085Link to BLAST:NP_036085.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_036085.1 320 Q9R060 320 100% 0 0

Chromosomal Locations for CCDS 27948.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 10411977 10411995 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 10412070 10412174 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 10413611 10413744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 10417661 10417729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 10419653 10419685 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 10420256 10420346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 10420974 10421128 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 10421227 10421337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 10421577 10421679 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 10422822 10422905 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 10423241 10423299 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (963 nt):
ATGGAGGAGGCGCCCCACGGCTGCCCCGGGGCCGACAGCGCCCAGGCCGGCCGAGGAGCCTCGTGCCAGG
GA
TGCCCCAACCAGAGGCTGTGCGCATCCGGAGCCGGCGCTGCTCCGGATCCCGCCGTGGAGGAAATCAG
A
GAGAAGATGAAGACGGTGAGACACAAGCTCTTGGTGCTGTCTGGGAAAGGCGGCGTTGGGAAAAGCACG
TTC
AGTGCACACCTCGCCCACGGCCTAGCGGAGGATGGAGATACACAGGTTGCTCTTCTGGACATCGATA
TC
TGTGGGCCATCGATTCCCAAGATCATGGGCTTAGAAGGAGAGCAGGTTCACCAGAGCGGCTCCGGCTG
G
TCTCCAGTGTACGTGGATGACAATCTGGGGGTGATGTCAGTGGGCTTCCTGCTTAGCAGCCCAGATGAT
GCT
GTCATCTGGAGGGGACCAAAGAAAAATGGTATGATCAAGCAGTTCCTCCGTGATGTAGACTGGGGAG
AC
GTGGACTACCTCATCGTAGACACCCCGCCTGGCACGTCTGACGAACACCTCTCAGTGGTCCAGTACCT
G
GCTGCGGCACACATTGATGGGGCAGTGATCCTCACCACCCCTCAGGAGGTGGCCCTCCAGGATGTCCGG
AAA
GAGATCAGCTTCTGCCACAAGGTGAAGCTGCCCATCATTGGTGTGGTAGAAAACATGAGCGGTTTCA
TC
TGCCCCAAGTGCAAGAAAGAGTCTCAGATCTTCCCTCCCACGACTGGGGGTGCAGAGGCCATGTGCCA
G
GATCTGAGGATTCCACTTCTGGGCAAAGTGCCGCTGGATCCACACATAGGCAAGAGCTGTGACAAAGGC
CAG
TCTTTTTTTGTCGAAGCTCCAGATTCACCAGCCACAGCAGCCTACAGAAGTATAATTCAGAGGATCC
GA
GACTTTTGTAATTCTCATCAGTCACATGCTGAGACCCTCATCAGTCCCTGA


Translation (320 aa):
MEEAPHGCPGADSAQAGRGASCQGCPNQRLCASGAGAAPDPAVEEIREKMKTVRHKLLVLSGKGGVGKST
F
SAHLAHGLAEDGDTQ
VALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVDDNLGVMSVGFLLSSPDD
A
VIWRGPKKN
GMIKQFLRDVDWGDVDYLIVDTPPGTSDEHLSVVQYLAAAHIDGAVILTTPQEVALQDVR
K
EISFCHKVKLPIIGVVENMSGFICPKCK
KESQIFPPTTGGAEAMCQDLRIPLLGKVPLDPHIGKSCDKG
Q
SFFVEAPDSPATAAYRSIIQ
RIRDFCNSHQSHAETLISP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser